EY756465

Overview
NameEY756465
Unique NameEY756465
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length636
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3773 contig Csv1_Contig3773:973..1608. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756465 vs. ExPASy Swiss-Prot
Match: AFR_ARATH (F-box protein AFR OS=Arabidopsis thaliana GN=AFR PE=1 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 2.412e-35
Identity = 66/114 (57.89%), Postives = 87/114 (76.32%), Query Frame = 1
Query:   13 MSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCRVVY 354
            MS GMKEGWTG+S+V+  +LFVISEHGD PMK Y  DDDTWRYV G+K   E M RPFAV G + +++VV+SG+NVA GRV E QNG  S EW+++++P++    +P+SC V+Y
Sbjct:  258 MSGGMKEGWTGVSVVIRDRLFVISEHGDFPMKVYCSDDDTWRYVSGEKLQGEKMRRPFAVTGADDRVFVVASGINVAEGRVSEGQNGDFSVEWRMVSSPKSSIQFSPASCHVLY 371          
BLAST of EY756465 vs. ExPASy Swiss-Prot
Match: FBK17_ARATH (F-box/kelch-repeat protein At1g30090 OS=Arabidopsis thaliana GN=At1g30090 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.421e-19
Identity = 43/115 (37.39%), Postives = 75/115 (65.22%), Query Frame = 1
Query:   13 MSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCRVVYA 357
            MS G++EGWTG S+V+  +LF++SE     MK Y+P  D+W  + G + P E + RPFAVN    ++YVV   L++A+G +++ +N   +  W+V+ +P  + D+ PS+ ++++A
Sbjct:  286 MSMGLREGWTGTSVVIYDRLFIVSELERMKMKVYDPVTDSWETINGPELP-EQICRPFAVNCYGNRVYVVGRNLHLAVGNIWQSEN-KFAVRWEVVESPERYADITPSNSQILFA 398          
The following BLAST results are available for this feature:
BLAST of EY756465 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
AFR_ARATH2.412e-3557.89F-box protein AFR OS=Arabidopsis thaliana GN=AFR P... [more]
FBK17_ARATH1.421e-1937.39F-box/kelch-repeat protein At1g30090 OS=Arabidopsi... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-H08-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756465 ID=EY756465|Name=EY756465|organism=Citrus sinensis|type=EST|length=636bp
CCACGCGTCCGGATGAGCGATGGGATGAAGGAAGGATGGACTGGGATCAG
TATCGTGCTTGAAGGCAAGCTGTTCGTGATATCAGAGCACGGTGACTGTC
CAATGAAGCAGTACAACCCTGATGACGACACGTGGCGGTATGTGGGTGGG
GACAAATTCCCATGTGAAGTTATGCATAGGCCGTTTGCAGTGAATGGAGT
GGAAGGGAAAATTTATGTGGTGTCAAGTGGGTTAAACGTGGCAATCGGAA
GGGTATATGAGGAACAAAATGGGGGAATTTCAGCGGAGTGGAAAGTTATG
ACTGCCCCTAGGGCGTTCAAGGACTTAGCACCCTCCAGTTGCCGAGTGGT
CTACGCTTAAACTAATTGAAGTGTTTGTCTTTGAGCCAATAATGCTGCGC
CAATCATTCATCATAAGGCCAGGTTGTAGTTTATCTGCTAATCTCGGCCT
AACCTTGACATGATTTTGTTTCTATTACGCTGCTTACTTCATAAAGTGTT
TGCCTGCTTTTTGATTTCGTATCTGTAAGCGACAGCCACAGCTGTGTANG
TAGAATGTGTGTTACTACTTCCTATTTTGTTTGGTTGGGAGTTGTAATCA
TCATTACTATGAAATAAAAAAAAGAAAATAGGGCAG
back to top