EY756464

Overview
NameEY756464
Unique NameEY756464
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length502
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2492 contig Csv1_Contig2492:1168..1658. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756464 vs. ExPASy Swiss-Prot
Match: ISPH_CYAP4 (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ispH PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.312e-28
Identity = 58/91 (63.74%), Postives = 75/91 (82.42%), Query Frame = 1
Query:   13 VDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIK 285
            +DL++V+GG+NSSNT+HLQEI+ +R IPSY IDS  RIGPGN++ +K +H  L  KENWLP+G I +GITSGASTPDK V DVL+K+F +K
Sbjct:  307 LDLMVVIGGFNSSNTTHLQEISIEREIPSYHIDSADRIGPGNRVEHKPLHRPLEIKENWLPEGPIVVGITSGASTPDKVVSDVLEKIFALK 397          
BLAST of EY756464 vs. ExPASy Swiss-Prot
Match: ISPH_SYNP6 (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ispH PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.713e-28
Identity = 57/92 (61.96%), Postives = 78/92 (84.78%), Query Frame = 1
Query:   13 VDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIKR 288
            +DLI+V+GG+NSSNT+HLQEIA +R IPS+ ID+ +RIGPGN+I +K +H +L   E WLP G +TIGITSGASTPDK VEDV++++F+++R
Sbjct:  306 LDLIVVIGGFNSSNTTHLQEIAIERQIPSFHIDAAERIGPGNRIEHKPLHTDLTTTEPWLPAGPLTIGITSGASTPDKVVEDVIERLFDLQR 397          
BLAST of EY756464 vs. ExPASy Swiss-Prot
Match: ISPH_SYNE7 (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Synechococcus elongatus (strain PCC 7942) GN=ispH PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.713e-28
Identity = 57/92 (61.96%), Postives = 78/92 (84.78%), Query Frame = 1
Query:   13 VDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIKR 288
            +DLI+V+GG+NSSNT+HLQEIA +R IPS+ ID+ +RIGPGN+I +K +H +L   E WLP G +TIGITSGASTPDK VEDV++++F+++R
Sbjct:  306 LDLIVVIGGFNSSNTTHLQEIAIERQIPSFHIDAAERIGPGNRIEHKPLHTDLTTTEPWLPAGPLTIGITSGASTPDKVVEDVIERLFDLQR 397          
BLAST of EY756464 vs. ExPASy Swiss-Prot
Match: ISPH_THEEB (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Thermosynechococcus elongatus (strain BP-1) GN=ispH PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.111e-27
Identity = 58/91 (63.74%), Postives = 72/91 (79.12%), Query Frame = 1
Query:   13 VDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIK 285
            +DL++V+GG+NSSNT+HLQEIA + GIPSY IDS  RIGPGN+I +K +H      ENWLP   ITIGITSGASTPDK VE+VL K+F ++
Sbjct:  306 LDLMVVIGGYNSSNTTHLQEIAIEHGIPSYHIDSADRIGPGNRIEHKPLHQNPTVAENWLPDRPITIGITSGASTPDKVVEEVLNKIFALR 396          
BLAST of EY756464 vs. ExPASy Swiss-Prot
Match: ISPH_ACAM1 (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Acaryochloris marina (strain MBIC 11017) GN=ispH PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.111e-27
Identity = 54/95 (56.84%), Postives = 75/95 (78.95%), Query Frame = 1
Query:   13 VDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIKREEA 297
            +DL++V+GG+NSSNT+HLQEI+ D+ IPSY IDS  RIGPGN++ +K ++ +L   +NWLP G + IG+TSGASTPDK V D+++K+F IK   A
Sbjct:  315 LDLMVVIGGFNSSNTTHLQEISIDKNIPSYHIDSVDRIGPGNRVEHKPLNADLTVTDNWLPNGPLAIGVTSGASTPDKVVSDIVEKIFSIKSASA 409          
BLAST of EY756464 vs. ExPASy Swiss-Prot
Match: ISPH_CYAA5 (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Cyanothece sp. (strain ATCC 51142) GN=ispH PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 4.220e-27
Identity = 56/96 (58.33%), Postives = 77/96 (80.21%), Query Frame = 1
Query:   13 VDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIKREEAL 300
            VD+++V+GG+NSSNT+HLQEI+ ++GI SY IDS+KRI PGNKI +K +  ++  KENWLP G+I +G+TSGASTPDK VE V++++FE K    L
Sbjct:  306 VDVMVVIGGFNSSNTTHLQEISIEKGIDSYHIDSDKRILPGNKIEHKPLEKDIETKENWLPDGKIIVGVTSGASTPDKVVEAVIERIFEEKNAGVL 401          
BLAST of EY756464 vs. ExPASy Swiss-Prot
Match: ISPH_ANAVT (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ispH PE=3 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.094e-26
Identity = 53/96 (55.21%), Postives = 77/96 (80.21%), Query Frame = 1
Query:   13 VDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIKREEAL 300
            +DL++V+GG+NSSNT+ LQ+I+++RG+PSY ID  +RI   N I ++ ++GELV  ENWLP G+I +G+TSGASTPDK VEDV++K+F +K   A+
Sbjct:  306 LDLMIVIGGFNSSNTTQLQQISQERGLPSYHIDVVERIKSVNSIEHRQLNGELVTTENWLPAGKIVVGVTSGASTPDKVVEDVIEKIFALKATTAV 401          
BLAST of EY756464 vs. ExPASy Swiss-Prot
Match: ISPH_ANASP (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Anabaena sp. (strain PCC 7120) GN=ispH PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 2.735e-26
Identity = 53/96 (55.21%), Postives = 77/96 (80.21%), Query Frame = 1
Query:   13 VDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIKREEAL 300
            +DL++V+GG+NSSNT+ LQ+I+++RG+PSY ID  +RI   N I ++ ++GELV  ENWLP G+I +G+TSGASTPDK VEDV++K+F +K   A+
Sbjct:  306 LDLMIVIGGFNSSNTTQLQQISQERGLPSYHIDVVERIKSINSIEHRQLNGELVTTENWLPAGKIVVGVTSGASTPDKVVEDVIEKIFALKATAAV 401          
BLAST of EY756464 vs. ExPASy Swiss-Prot
Match: ISPH_NOSP7 (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ispH PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 7.959e-26
Identity = 53/96 (55.21%), Postives = 77/96 (80.21%), Query Frame = 1
Query:   13 VDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIKREEAL 300
            ++L++V+GG+NSSNT+ LQ+IA +R IPSY ID+ +RI  G+ I ++ ++G+L+  ENWLP G+I +GITSGASTPDK VEDV++K+F +K   AL
Sbjct:  306 LNLMVVIGGFNSSNTTQLQQIAFERRIPSYHIDTVERIKSGDSIEHRQLNGQLITTENWLPDGEIVVGITSGASTPDKVVEDVIEKIFAVKATAAL 401          
BLAST of EY756464 vs. ExPASy Swiss-Prot
Match: ISPH_SYNY3 (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Synechocystis sp. (strain PCC 6803) GN=ispH PE=3 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 1.039e-25
Identity = 54/94 (57.45%), Postives = 73/94 (77.66%), Query Frame = 1
Query:   13 VDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIKREE 294
            + L++V+GG+NSSNT+HLQEIA + GIPS  IDS  RIGPGN++ +K +  +L   E WLP G+IT+G+TSGASTPDK VE+V+KK+  IK  +
Sbjct:  279 LSLMVVIGGFNSSNTTHLQEIAVEHGIPSVHIDSGDRIGPGNRVEHKPLGKDLEVLEPWLPAGKITVGVTSGASTPDKVVEEVMKKILAIKEAQ 372          
The following BLAST results are available for this feature:
BLAST of EY756464 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
ISPH_CYAP41.312e-2863.744-hydroxy-3-methylbut-2-enyl diphosphate reductase... [more]
ISPH_SYNP61.713e-2861.964-hydroxy-3-methylbut-2-enyl diphosphate reductase... [more]
ISPH_SYNE71.713e-2861.964-hydroxy-3-methylbut-2-enyl diphosphate reductase... [more]
ISPH_THEEB1.111e-2763.744-hydroxy-3-methylbut-2-enyl diphosphate reductase... [more]
ISPH_ACAM11.111e-2756.844-hydroxy-3-methylbut-2-enyl diphosphate reductase... [more]
ISPH_CYAA54.220e-2758.334-hydroxy-3-methylbut-2-enyl diphosphate reductase... [more]
ISPH_ANAVT2.094e-2655.214-hydroxy-3-methylbut-2-enyl diphosphate reductase... [more]
ISPH_ANASP2.735e-2655.214-hydroxy-3-methylbut-2-enyl diphosphate reductase... [more]
ISPH_NOSP77.959e-2655.214-hydroxy-3-methylbut-2-enyl diphosphate reductase... [more]
ISPH_SYNY31.039e-2557.454-hydroxy-3-methylbut-2-enyl diphosphate reductase... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-H07-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756464 ID=EY756464|Name=EY756464|organism=Citrus sinensis|type=EST|length=502bp
CCACGCGTCCGGGTCGATCTTATCTTGGTTGTTGGTGGGTGGAACTCGAG
CAATACCTCACACCTTCAAGAGATTGCAGAAGACCGTGGAATTCCCTCAT
ACTGGATCGATAGTGAGAAGAGAATAGGTCCCGGAAACAAAATAGCATAT
AAATTGATGCATGGTGAGCTGGTGGAGAAAGAAAATTGGCTGCCGAAAGG
CCAGATCACAATCGGTATAACATCCGGTGCCTCCACCCCAGATAAGGCTG
TTGAAGACGTCCTTAAAAAGGTATTTGAGATCAAGCGTGAAGAAGCCTTG
CAATTAGCGTAAACTGAGGTCCAAACATACACATTATCAATAAAGTTCGA
TGTGATTGTATCACTAGATATTGTAAAATTATAAACACAGCCCTCTGCCG
GGTCTTTTATCAGTGCCCATGTAATCTGAAATTTATATTTTTTGTGCAAT
ATGAAGCTAGAGATTACAATTTCTAACCAAAAAAAAAAAAAAAAAAAAAA
AA
back to top