EY756463

Overview
NameEY756463
Unique NameEY756463
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length919
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7608 contig Csv1_Contig7608:182..1103. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756463 vs. ExPASy Swiss-Prot
Match: CATA1_GOSHI (Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 PE=2 SV=2)

HSP 1 Score: 522.702 bits (1345), Expect = 1.137e-147
Identity = 245/283 (86.57%), Postives = 257/283 (90.81%), Query Frame = 2
Query:   23 TYMLINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNNNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP*ICGGRREKCIIPKETT-SNSWRRYRSSAPDRQERFICRWVDALSDPRVTHEIXHIWISYWPQACKSLGQKVASRLNVEPT 868
            TY LINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIA+GNYPEWKL+IQ +DPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLN NIDNFFAENEQLAFCPAIVVPGIYYS+DKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCA HNNH++GFMNFMHRDEEI+YFPSRYDPVRHAEM P PP +C GRREKCII KE        RYRS A DRQERFICRWVDALSDPRVTHEI  IWISYW QA KS+GQK+AS LNV P+
Sbjct:  209 TYTLINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLFIQTIDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASLLNVRPS 491          
BLAST of EY756463 vs. ExPASy Swiss-Prot
Match: CATA3_NICPL (Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN=CAT3 PE=2 SV=1)

HSP 1 Score: 509.99 bits (1312), Expect = 7.629e-144
Identity = 236/283 (83.39%), Postives = 256/283 (90.46%), Query Frame = 2
Query:   23 TYMLINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNNNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP*ICGGRREKCIIPKETT-SNSWRRYRSSAPDRQERFICRWVDALSDPRVTHEIXHIWISYWPQACKSLGQKVASRLNVEPT 868
            TYMLINKAGKAHYVKFHWKPTCGVKCLLE+EAIKVGGANHSHAT+DLYDSIA+GNYPEWKL+IQI+DPDHED+FDFDPLDVTKTWPEDILPLQPVGRLVLN NIDNFFAENEQLAF PAIVVPG+Y S+DKLLQTRIFSY+D QRHRLGPNYLQLPVNAPKCA HNNH++GFMNFMHRDEE++YFPSR+DP RHAE +P PP +  G+R+KCII KE        RYRS APDRQERFICRWVDALSDPRVTHEI  IW SYW QA K+LGQK+ASRLNV PT
Sbjct:  209 TYMLINKAGKAHYVKFHWKPTCGVKCLLEEEAIKVGGANHSHATKDLYDSIAAGNYPEWKLFIQIIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFWPAIVVPGVYCSDDKLLQTRIFSYSDAQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKIASRLNVRPT 491          
BLAST of EY756463 vs. ExPASy Swiss-Prot
Match: CATA_SOLAP (Catalase OS=Soldanella alpina PE=2 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 1.301e-143
Identity = 232/283 (81.98%), Postives = 256/283 (90.46%), Query Frame = 2
Query:   23 TYMLINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNNNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP*ICGGRREKCIIPKETT-SNSWRRYRSSAPDRQERFICRWVDALSDPRVTHEIXHIWISYWPQACKSLGQKVASRLNVEPT 868
            TY LINKAGKA YVKFHWKPTCGVKCLLEDEAIKVGGANHSHAT+DLYDSI++GNYPEWKL+IQI++PDHEDKFDFDPLDVTKTWPEDI+PL PVGRLVLN NIDNFFAENEQLAFCPA++VPG+YYS+DKLLQTRIFSYADTQRHRLGPNYLQLP NAPKCA HNNH++G MNFMHRDEE++YFPSR+DPVRHAE HP PP +  G+R++C+I KE        RYR+ APDRQERF+CRWVDALSDPRVTHEI  IWISYW QA KSLGQK+ASRLNV PT
Sbjct:  209 TYTLINKAGKAQYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATKDLYDSISAGNYPEWKLFIQIIEPDHEDKFDFDPLDVTKTWPEDIIPLMPVGRLVLNKNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPT 491          
BLAST of EY756463 vs. ExPASy Swiss-Prot
Match: CATA2_ARATH (Catalase-2 OS=Arabidopsis thaliana GN=CAT2 PE=1 SV=3)

HSP 1 Score: 504.212 bits (1297), Expect = 4.186e-142
Identity = 231/283 (81.63%), Postives = 256/283 (90.46%), Query Frame = 2
Query:   23 TYMLINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNNNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP*ICGGRREKCIIPKETT-SNSWRRYRSSAPDRQERFICRWVDALSDPRVTHEIXHIWISYWPQACKSLGQKVASRLNVEPT 868
            TYMLINKAGKAHYVKFHWKPTCGVK LLE++AI+VGG NHSHATQDLYDSIA+GNYPEWKL+IQI+DP  EDKFDFDPLDVTKTWPEDILPLQPVGR+VLN NIDNFFAENEQLAFCPAI+VPGI+YS+DKLLQTR+FSYADTQRHRLGPNYLQLPVNAPKCA HNNH++GFMNFMHRDEE++YFPSRYD VRHAE +PTPP +C G+RE+CII KE        RYR+  P+RQERFI RW+DALSDPR+THEI  IWISYW QA KSLGQK+ASRLNV P+
Sbjct:  209 TYMLINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPS 491          
BLAST of EY756463 vs. ExPASy Swiss-Prot
Match: CATA2_GOSHI (Catalase isozyme 2 OS=Gossypium hirsutum GN=CAT2 PE=2 SV=1)

HSP 1 Score: 501.13 bits (1289), Expect = 3.544e-141
Identity = 231/283 (81.63%), Postives = 253/283 (89.40%), Query Frame = 2
Query:   23 TYMLINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNNNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP*ICGGRREKCIIPKETT-SNSWRRYRSSAPDRQERFICRWVDALSDPRVTHEIXHIWISYWPQACKSLGQKVASRLNVEPT 868
            TY LINKAGK+HYVKFHWKPTCGVK LLEDEAI+VGGANHSHATQDLYDSIA+GNYPEWKL+IQIMDP HED+FDFDPLDVTKTWPEDI PLQP+GR+VLN NIDNFFAENEQLAFCP+++VPGIYYS+DKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCA HNNH++GFMNFMHRDEE++YFPSRYDPVRHAE HP P  +  G+REKCII KE        RYRS + DRQERFI RW+DALSDPRVTHEI  IWISYW QA KSLGQK+ASRLNV P+
Sbjct:  209 TYTLINKAGKSHYVKFHWKPTCGVKSLLEDEAIRVGGANHSHATQDLYDSIAAGNYPEWKLFIQIMDPLHEDRFDFDPLDVTKTWPEDIFPLQPMGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPS 491          
BLAST of EY756463 vs. ExPASy Swiss-Prot
Match: CATA1_CUCPE (Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 SV=1)

HSP 1 Score: 498.049 bits (1281), Expect = 3.000e-140
Identity = 227/283 (80.21%), Postives = 253/283 (89.40%), Query Frame = 2
Query:   23 TYMLINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNNNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP*ICGGRREKCIIPKETT-SNSWRRYRSSAPDRQERFICRWVDALSDPRVTHEIXHIWISYWPQACKSLGQKVASRLNVEPT 868
            TY LINKAGKAHYVKFHW+PTCGVK LLE++AI+VGG+NHSHATQDLYDSIA+GNYPEWKL+IQ +DPDHEDK+DFDPLDVTKTWPEDILPLQPVGR+VLN NIDNFFAENEQLAFCPAI+VPG+YYS+DKLLQTRIFSYADTQRHRLGPNYLQLP NAPKCA HNNH++GFMNFMHRDEE++YFPSR+DP RHAE +P PP +C G+RE+CII KE        RYRS  PDRQERF+ RWVDALSD RVTHEI  IWISYW QA +SLGQK+AS LNV P+
Sbjct:  209 TYTLINKAGKAHYVKFHWRPTCGVKSLLEEDAIRVGGSNHSHATQDLYDSIAAGNYPEWKLFIQTIDPDHEDKYDFDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPS 491          
BLAST of EY756463 vs. ExPASy Swiss-Prot
Match: CATA_HELAN (Catalase OS=Helianthus annuus PE=2 SV=1)

HSP 1 Score: 497.278 bits (1279), Expect = 5.117e-140
Identity = 230/284 (80.99%), Postives = 250/284 (88.03%), Query Frame = 2
Query:   23 TYMLINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNNNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP*ICGGRREKCIIPKETT-SNSWRRYRSSAPDRQERFICRWVDALSDPRVTHEIXHIWISYWPQACKSLGQKVASRLNVEPTF 871
            TY LINKAGKA+YVKFHWKPTCGVK LLE+EAIK+GGANHSHATQDLYDSIA+GNYPEWKL+IQ +DPDHED+ DFDPLDVTKTWPEDI PLQPVGRLVLN NIDNFFAENEQLAFCPAI+VPGIYYS+DKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCA HNNHYDGFMNFMHRDEEIDYFPSRYDP RHAE +P PP    G+R+KC+I KE        RYRS +PDRQERFI R V  LSDPRVTHE+  IW+SYW QA KSLGQK+ASRLNV+P +
Sbjct:  209 TYTLINKAGKAYYVKFHWKPTCGVKSLLEEEAIKIGGANHSHATQDLYDSIAAGNYPEWKLFIQTIDPDHEDRLDFDPLDVTKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKPNY 492          
BLAST of EY756463 vs. ExPASy Swiss-Prot
Match: CATA1_NICPL (Catalase isozyme 1 (Fragment) OS=Nicotiana plumbaginifolia GN=CAT1 PE=2 SV=1)

HSP 1 Score: 490.73 bits (1262), Expect = 4.789e-138
Identity = 228/283 (80.57%), Postives = 249/283 (87.99%), Query Frame = 2
Query:   23 TYMLINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNNNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP*ICGGRREKCIIPKETT-SNSWRRYRSSAPDRQERFICRWVDALSDPRVTHEIXHIWISYWPQACKSLGQKVASRLNVEPT 868
            T+ LINKAGK+ YVKFHWKPTCGVK LLEDEA +VGGANHSHATQDLYDSIA+GNYPEWKL+IQ MDPDHED+FDFDPLDVTKTWPEDILPLQPVGRLVLN NIDNF  ENEQLAFCP+IVVPG+YYS+DK+LQTRIFSY+DTQR+RLGPNYLQLP NAPKCA HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +P P  +C G+REKC+I KE        RYRS  PDRQERFI RWV+ LSDPR+T+EI  IWISYW QA KSLGQK+ASRLNV P+
Sbjct:  202 TFTLINKAGKSTYVKFHWKPTCGVKSLLEDEAARVGGANHSHATQDLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFSNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPS 484          
BLAST of EY756463 vs. ExPASy Swiss-Prot
Match: CATA4_SOYBN (Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1)

HSP 1 Score: 489.96 bits (1260), Expect = 8.170e-138
Identity = 226/282 (80.14%), Postives = 249/282 (88.30%), Query Frame = 2
Query:   23 TYMLINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNNNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP*ICGGRREKCIIPKETT-SNSWRRYRSSAPDRQERFICRWVDALSDPRVTHEIXHIWISYWPQACKSLGQKVASRLNVEP 865
            TY LINKAGKA YVKFHWK T G+KCLLE+EAIKVGGANHSHATQDL+DSIA+GNYPEWKL++Q +DP+HEDKFDFDPLDVTKTWPEDI+PLQPVGRLVLN NIDNFFAENEQLAFCPAIVVPG+YYS+DK+LQTRIFSYAD+QRHRLGPNYLQLP NAPKCA HNNH++GFMNF+HRDEE++YFPSRYDPVRHAE  P PP IC GRREKC I KE        RYRS APDRQ+RF  RWVDALSDPRVTHEI  +WISYW QA +SLGQK+AS L+  P
Sbjct:  209 TYTLINKAGKAVYVKFHWKTTSGIKCLLEEEAIKVGGANHSHATQDLHDSIAAGNYPEWKLFVQTIDPEHEDKFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSTRP 490          
BLAST of EY756463 vs. ExPASy Swiss-Prot
Match: CATA1_ARATH (Catalase-1 OS=Arabidopsis thaliana GN=CAT1 PE=1 SV=3)

HSP 1 Score: 489.96 bits (1260), Expect = 8.170e-138
Identity = 225/284 (79.23%), Postives = 251/284 (88.38%), Query Frame = 2
Query:   23 TYMLINKAGKAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNNNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPP*ICGGRREKCIIPKETT-SNSWRRYRSSAPDRQERFICRWVDALSDPRVTHEIXHIWISYWPQACKSLGQKVASRLNVEPTF 871
            TYMLINKAGKAHYVKFHWKPTCG+KCL ++EAI+VGGANHSHAT+DLYDSIA+GNYP+W L++Q+MDP HEDKFDFDPLDVTK WPEDILPLQPVGRLVLN NIDNFF ENEQ+AFCPA+VVPGI+YS+DKLLQTRIFSYAD+QRHRLGPNYLQLPVNAPKCA HNNH+DGFMNFMHRDEE++YFPSR DPVRHAE +PT P +C G REKC I KE        RYRS   DRQERF+ R+V+ALS+PRVTHEI  IWISYW QA KSLGQK+A+RLNV P F
Sbjct:  209 TYMLINKAGKAHYVKFHWKPTCGIKCLSDEEAIRVGGANHSHATKDLYDSIAAGNYPQWNLFVQVMDPAHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRPNF 492          
The following BLAST results are available for this feature:
BLAST of EY756463 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 141
Match NameE-valueIdentityDescription
CATA1_GOSHI1.137e-14786.57Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 P... [more]
CATA3_NICPL7.629e-14483.39Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN... [more]
CATA_SOLAP1.301e-14381.98Catalase OS=Soldanella alpina PE=2 SV=1[more]
CATA2_ARATH4.186e-14281.63Catalase-2 OS=Arabidopsis thaliana GN=CAT2 PE=1 SV... [more]
CATA2_GOSHI3.544e-14181.63Catalase isozyme 2 OS=Gossypium hirsutum GN=CAT2 P... [more]
CATA1_CUCPE3.000e-14080.21Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 ... [more]
CATA_HELAN5.117e-14080.99Catalase OS=Helianthus annuus PE=2 SV=1[more]
CATA1_NICPL4.789e-13880.57Catalase isozyme 1 (Fragment) OS=Nicotiana plumbag... [more]
CATA4_SOYBN8.170e-13880.14Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1[more]
CATA1_ARATH8.170e-13879.23Catalase-1 OS=Arabidopsis thaliana GN=CAT1 PE=1 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-H06-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756463 ID=EY756463|Name=EY756463|organism=Citrus sinensis|type=EST|length=919bp
CCACGCGTCCGTCTGGTGTTTCACTTACATGCTGATCAATAAGGCTGGGA
AAGCACATTATGTGAAATTTCATTGGAAACCCACTTGTGGGGTTAAGTGT
TTATTGGAAGATGAGGCAATCAAGGTTGGAGGAGCCAACCACAGCCATGC
TACTCAAGATCTTTATGACTCAATTGCATCTGGAAACTATCCTGAGTGGA
AACTCTACATCCAGATTATGGATCCCGACCATGAGGACAAATTTGACTTT
GACCCACTTGATGTAACCAAGACCTGGCCTGAGGACATCTTGCCCTTGCA
ACCTGTGGGCCGGTTGGTTTTGAACAACAACATTGATAACTTCTTTGCAG
AGAATGAACAGCTTGCTTTCTGCCCTGCTATTGTGGTTCCTGGCATCTAC
TATTCAAATGATAAGTTGCTCCAGACTCGAATCTTCTCCTATGCTGATAC
TCAGAGGCACCGTCTAGGGCCGAACTATCTTCAACTCCCAGTAAATGCAC
CCAAATGTGCTCAGCACAACAATCATTATGACGGTTTCATGAATTTCATG
CACAGGGATGAGGAGATCGATTACTTCCCTTCAAGGTATGATCCTGTCCG
TCATGCTGAGATGCATCCAACTCCTCCCTGAATCTGCGGCGGAAGGCGCG
AGAAGTGCATAATTCCAAAGGAAACTACTTCAAACAGCTGGAGAAGATAC
CGATCTTCGGCACCAGACAGGCAAGAGCGATTCATCTGCAGATGGGTTGA
TGCTTTATCTGATCCACGCGTCACCCATGAGATCCNGCACATATGGATCT
CATACTGGCCTCAGGCTTGCAAGTCTCTGGGTCAGAAAGTTGCATCTCGT
CTGAATGTGGAGCCTACATTTTACTGTGATGCGAAGCTGAGGGACTCACA
AGAGTTTCNAGGAGTAACC
back to top