EY756462

Overview
NameEY756462
Unique NameEY756462
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756462 vs. ExPASy Swiss-Prot
Match: RPN6_SCHPO (Probable 26S proteasome regulatory subunit rpn6 OS=Schizosaccharomyces pombe GN=rpn6 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.689e-41
Identity = 84/149 (56.38%), Postives = 106/149 (71.14%), Query Frame = 1
Query:   13 KAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDHGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIM 459
            K  ++Y G +++AM+A+A AH  RSL  FE AL+D+K +L  DPI+  HLSSLYD LLEQNL R++EP+SRVE++HIAELI L    VE KLSQMILDK F G LD G GCLI++++P+ D  Y A LE I NMG VVD L    A  +
Sbjct:  272 KHAIRYAGRDIEAMRAIAQAHENRSLADFEKALQDYKPELASDPIIRSHLSSLYDNLLEQNLLRVVEPFSRVEVSHIAELIGLSTVQVEGKLSQMILDKIFYGILDQGSGCLIVYDEPQQDKTYEAALEVIKNMGTVVDLLIENKASAL 420          
BLAST of EY756462 vs. ExPASy Swiss-Prot
Match: PSD11_MOUSE (26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus GN=Psmd11 PE=1 SV=3)

HSP 1 Score: 167.933 bits (424), Expect = 4.916e-41
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   13 KAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDHGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKI 456
            K  L+Y G + +A+K VA A   RSL  FE AL D++A+L +DPI+  HL+ LYD LLEQNL R+IEP+SRV+I HI+ LI+L    VE+KLSQMILDKKF G LD G G LIIF++P  D  Y A LETI NM KVVDSL+ ++ K+
Sbjct:  274 KLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYSKAKKL 421          
BLAST of EY756462 vs. ExPASy Swiss-Prot
Match: PSD11_HUMAN (26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens GN=PSMD11 PE=1 SV=3)

HSP 1 Score: 167.548 bits (423), Expect = 6.420e-41
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   13 KAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDHGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKI 456
            K  L+Y G + +A+K VA A   RSL  FE AL D++A+L +DPI+  HL+ LYD LLEQNL R+IEP+SRV+I HI+ LI+L    VE+KLSQMILDKKF G LD G G LIIF++P  D  Y A LETI NM KVVDSL+ ++ K+
Sbjct:  274 KLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKL 421          
BLAST of EY756462 vs. ExPASy Swiss-Prot
Match: PSD11_BOVIN (26S proteasome non-ATPase regulatory subunit 11 OS=Bos taurus GN=PSMD11 PE=2 SV=3)

HSP 1 Score: 167.548 bits (423), Expect = 6.420e-41
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   13 KAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDHGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKI 456
            K  L+Y G + +A+K VA A   RSL  FE AL D++A+L +DPI+  HL+ LYD LLEQNL R+IEP+SRV+I HI+ LI+L    VE+KLSQMILDKKF G LD G G LIIF++P  D  Y A LETI NM KVVDSL+ ++ K+
Sbjct:  274 KLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKL 421          
BLAST of EY756462 vs. ExPASy Swiss-Prot
Match: PSD11_DICDI (26S proteasome non-ATPase regulatory subunit 11 OS=Dictyostelium discoideum GN=psmD11 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.697e-39
Identity = 77/149 (51.68%), Postives = 111/149 (74.50%), Query Frame = 1
Query:   13 KAGLQYVGPE-LDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDHGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKI 456
            K GL+Y     ++A+  ++ +H+KRSL +F+   ++F  QL +DPI+H HL+ LY  LLEQNLCR+IEP+SRVEI+HIA+LI+LP+D VE+KLS MILDKK+ G LD G G LI+FE+ K D ++  +LETI  + +VVD L+ ++ K+
Sbjct:  264 KIGLKYHNNRSIEAITQISKSHAKRSLHMFQEVTKEFSDQLSDDPIIHSHLTELYSNLLEQNLCRIIEPFSRVEISHIAKLIDLPVDVVERKLSLMILDKKYNGILDQGTGTLIVFEEQKEDKLFNCSLETIGALSRVVDLLYEKTNKL 412          
BLAST of EY756462 vs. ExPASy Swiss-Prot
Match: RPN6_YEAST (26S proteasome regulatory subunit RPN6 OS=Saccharomyces cerevisiae GN=RPN6 PE=1 SV=3)

HSP 1 Score: 140.584 bits (353), Expect = 8.404e-33
Identity = 70/141 (49.65%), Postives = 96/141 (68.09%), Query Frame = 1
Query:   28 YVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDHGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSA 450
            Y    +DAMKAVA+A++ RSL  F TAL+ ++ +L  D +   H ++LYDTLLE NLC++IEP+  VEI+HI+++I L    VE KLSQMILDK F G LD G G L ++E P  DA Y + LE +  + KVVD LF +++
Sbjct:  291 YQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKAS 431          
BLAST of EY756462 vs. ExPASy Swiss-Prot
Match: YMJ5_CAEEL (Uncharacterized protein F59B2.5 OS=Caenorhabditis elegans GN=F59B2.5 PE=2 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 1.644e-20
Identity = 54/139 (38.85%), Postives = 90/139 (64.75%), Query Frame = 1
Query:   37 PELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDHGVGCLIIFEDPKADAI--YPATLETISNMGKVVDSLFVRS 447
            P + A++++ADA  KRSLK F  AL + K +L ED +V  H  +L   +LE+ + R+IEPYS +E+++IA +I + +  VE+ +++MILDKK  G++D     ++++  PKADA   +  +L+TI  + K VD  + R+
Sbjct:  328 PRIIAIRSMADAFRKRSLKDFVKALAEHKIELVEDKVVAVHSQNLERNMLEKEISRVIEPYSEIELSYIARVIGMTVPPVERAIARMILDKKLMGSIDQHGDTVVVY--PKADAANQFTRSLKTIRELTKTVDVSYSRT 464          
The following BLAST results are available for this feature:
BLAST of EY756462 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
RPN6_SCHPO1.689e-4156.38Probable 26S proteasome regulatory subunit rpn6 OS... [more]
PSD11_MOUSE4.916e-4157.4326S proteasome non-ATPase regulatory subunit 11 OS... [more]
PSD11_HUMAN6.420e-4157.4326S proteasome non-ATPase regulatory subunit 11 OS... [more]
PSD11_BOVIN6.420e-4157.4326S proteasome non-ATPase regulatory subunit 11 OS... [more]
PSD11_DICDI2.697e-3951.6826S proteasome non-ATPase regulatory subunit 11 OS... [more]
RPN6_YEAST8.404e-3349.6526S proteasome regulatory subunit RPN6 OS=Saccharo... [more]
YMJ5_CAEEL1.644e-2038.85Uncharacterized protein F59B2.5 OS=Caenorhabditis ... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-H05-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756462 ID=EY756462|Name=EY756462|organism=Citrus sinensis|type=EST|length=730bp
CCACGCGTCCGTAAGGCTGGCCTGCAGTATGTTGGGCCAGAATTAGATGC
TATGAAAGCTGTTGCTGATGCTCATTCCAAGAGGTCCTTGAAGTTGTTTG
AGACTGCTCTACGTGATTTCAAGGCTCAGCTTGAGGAAGACCCAATTGTG
CATAGGCACCTCTCATCTCTGTATGACACACTTCTGGAACAAAACCTGTG
CAGGTTGATTGAGCCTTACTCAAGGGTAGAGATAGCACACATTGCAGAGC
TCATTGAGCTGCCGATAGATCATGTAGAGAAAAAGTTATCCCAAATGATT
TTGGACAAGAAATTTGCTGGGACATTAGATCACGGCGTTGGATGCCTCAT
CATATTTGAAGATCCTAAGGCAGATGCCATCTATCCTGCCACTTTAGAAA
CCATTTCCAACATGGGCAAGGTTGTGGACAGCCTTTTTGTGAGGTCTGCC
AAGATTATGGCATGAGGGTTTCTTTTGTGTTTTTTGGTGGACACTCCTTA
GTTCATGGGTCTGCTTCCTGACTTTCTATTGTTTCTGAATTATAGCAGAC
TTGATAATGGATATGTTAGCTAGGAACTTGATTCTACGTTCGCTGCTGNC
CGNCNTGCTGAGATGCATCCAACTCCTCCTGAAATCTGCAGCGAAAAGGG
CAAGAGGCGCCGCTCTAAAGGAATCAAGTTACGTACACGTGGATGAGAGA
TACTAATTCTTGCTATAGGACACCAAAAAT
back to top