EY756461

Overview
NameEY756461
Unique NameEY756461
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length785
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13329 contig Csv1_Contig13329:1..785. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756461 vs. ExPASy Swiss-Prot
Match: PSMF1_ARATH (Probable proteasome inhibitor OS=Arabidopsis thaliana GN=At3g53970 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.565e-27
Identity = 86/215 (40.00%), Postives = 101/215 (46.98%), Query Frame = 2
Query:   11 VKCLLMNSKLLVDALTEGASEPVHLQINVANYVAE-NGGNYSDKIQNLEKLATDLDKDIISKLYGSPK-------------------------------TARIPVPPINPSRG-SDLFPGPGAGMYPRRGGFGGDGSML----XXXXXXXXXXXXXXXXXXXXXXXXXXXXARCDXXXXXXXXXXXXKRFARD-PRWPDRTHPDLESRPGGADFI 541
            VKCL M+ KLLVDA+ +G +EP HL+I V +Y  E N G+YS + +NL+KL TDL  +II KL G PK                                + + VPPI  + G SDLFPGPGAGMYP RGGF GDGSML                                AR D             RF R  PR P   HPDLE  PGG+DFI
Sbjct:   89 VKCLAMDDKLLVDAIADGGAEPAHLEIKVGDYAEESNEGDYSAQFKNLDKLVTDLQSEIIDKLDGKPKPVASRAQSSSETNEEPRYYDDTPNPLGPQIHPSGVVVPPIPGNGGYSDLFPGPGAGMYPGRGGF-GDGSMLVGPTDPRFFPFGDGSDRPGFMGPPHPGMPPPGARFDPYGPPGVPGFEPGRFTRQPPRGPGGGHPDLEHFPGGSDFI 302          
The following BLAST results are available for this feature:
BLAST of EY756461 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PSMF1_ARATH1.565e-2740.00Probable proteasome inhibitor OS=Arabidopsis thali... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-H04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756461 ID=EY756461|Name=EY756461|organism=Citrus sinensis|type=EST|length=785bp
CCACGCGTCCGTGAAGTGTCTCCTGATGAACAGTAAATTGCTGGTTGATG
CATTAACTGAGGGAGCTTCGGAGCCTGTGCATCTCCAAATCAATGTTGCA
AACTACGTTGCAGAAAATGGAGGCAATTACTCTGATAAGATCCAGAATTT
AGAGAAGCTTGCGACAGATCTTGATAAAGACATTATTTCAAAATTATACG
GCTCCCCAAAAACAGCTAGAATTCCTGTTCCTCCTATCAACCCAAGTCGT
GGTAGCGATCTTTTTCCTGGCCCTGGTGCTGGAATGTATCCTAGAAGGGG
TGGCTTTGGCGGTGATGGGAGCATGCTAATAGGACCTGATCATCCTGGCT
TTTTTGGAGGAATTGGTGGAGACCCTAATTTTCCTGGAGGGAACCCACCT
GTTCCTCCAGGTGCTCGTTGTGATCCCTACGGTCCGCCTGAAATTCCTGG
ATATGAACCTAAGCGGTTTGCCAGAGACCCACGATGGCCTGATCGGACTC
ATCCAGACCTGGAGTCTCGCCCGGGTGGTGCTGATTTTATCTAACAGACT
TCCTGGAGCGCGTTGATCCACATACAATTGTTTTCGATCTTGTCTGTTTT
GGCTGGGAATTTCATTCCAGCCGTGTAGATCTTCAGTTTATATTGTGGCT
TGAGTTATAGCATCTTGTATACTCTGGTTTCTTGACGTTTCTGTATGGAC
GGGTAAGTATTTTGCCGAGCCAATGACAAGTAGTAAACTCACAAATAGCT
TATTAAAGTTTGCTACATAAAACAAAAAAATAAAA
back to top