EY756460

Overview
NameEY756460
Unique NameEY756460
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length660
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12425 contig Csv1_Contig12425:177..831. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756460 vs. ExPASy Swiss-Prot
Match: RBS_LACSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Lactuca sativa GN=RBCS PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 8.380e-71
Identity = 118/150 (78.67%), Postives = 134/150 (89.33%), Query Frame = 3
Query:   12 SSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATHVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPGV 461
            S+ AFP TKK NND +S+ SNGGRVQCMKVWPP GLKK+ETLSYLPPLSDEAL KEI YL+R+ WIPCLEFELE G+VYREHH SPGYYDGRYWTMWKLPM+GCTD+  V+KEVGE +KEYP++F+R+IGFDN RQVQCISF+ AKPPGV
Sbjct:   31 SNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFIRVIGFDNIRQVQCISFIVAKPPGV 180          
BLAST of EY756460 vs. ExPASy Swiss-Prot
Match: RBS_BETVE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Betula verrucosa GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.295e-67
Identity = 117/150 (78.00%), Postives = 131/150 (87.33%), Query Frame = 3
Query:   12 SSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATHVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPGV 461
            S+SAFP T+KTNNDITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E L KE+ YLLR   IPCLEFELE G+VYREH+ SPGYYDGRYWTMWKLPM+GC D++ VLKE+ E +K YP +F+RIIGFDNKRQVQ ISF+A KPPGV
Sbjct:   33 STSAFPVTQKTNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSEQLAKEVDYLLRKNLIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKELEECKKAYPSAFIRIIGFDNKRQVQIISFIAYKPPGV 182          
BLAST of EY756460 vs. ExPASy Swiss-Prot
Match: RBS_PYRPY (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Pyrus pyrifolia GN=RBCS PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 7.341e-67
Identity = 116/149 (77.85%), Postives = 131/149 (87.92%), Query Frame = 3
Query:   12 SSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATHVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 458
            SSSAFP T+K+N DITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E+L KE+ YLLR  W+PCLEFELE G+VYRE+H SPGYYDGRYWTMWKLPM+GCTD++ VLKE+ E +K YP SF+RIIGFDN RQVQCISF+A KP G
Sbjct:   35 SSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
BLAST of EY756460 vs. ExPASy Swiss-Prot
Match: RBS_RAPSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Raphanus sativus GN=RBCS PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 8.116e-66
Identity = 113/148 (76.35%), Postives = 128/148 (86.49%), Query Frame = 3
Query:   12 SSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATHVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 455
            SS+AFP T+KTN DITSIASNGGRV CMKVWPP G KKFETLSYLP LSD  L KE+ YLLR+ WIPC+EFELE G+VYREH S+PGYYDGRYWTMWKLP++GCTD+  VLKEV E +KEYP++ +RIIGFDN RQVQCISF+A KPP
Sbjct:   29 SSAAFPVTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNALIRIIGFDNNRQVQCISFIAYKPP 176          
BLAST of EY756460 vs. ExPASy Swiss-Prot
Match: RBS_MALSP (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Malus sp. GN=RBCS PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 8.116e-66
Identity = 115/149 (77.18%), Postives = 130/149 (87.25%), Query Frame = 3
Query:   12 SSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATHVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 458
            SSSA P T+K+N DITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E+L KE+ YLLR  W+PCLEFELE G+VYRE+H SPGYYDGRYWTMWKLPM+GCTD++ VLKE+ E +K YP SF+RIIGFDN RQVQCISF+A KP G
Sbjct:   35 SSSASPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
BLAST of EY756460 vs. ExPASy Swiss-Prot
Match: RBS3B_ARATH (Ribulose bisphosphate carboxylase small chain 3B, chloroplastic OS=Arabidopsis thaliana GN=RBCS-3B PE=1 SV=2)

HSP 1 Score: 249.595 bits (636), Expect = 1.060e-65
Identity = 113/148 (76.35%), Postives = 128/148 (86.49%), Query Frame = 3
Query:   12 SSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATHVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 455
            SS+AFP T+KTN DITSIASNGGRV CMKVWPP G KKFETLSYLP LSD  L KE+ YLLR+ WIPC+EFELE G+VYREH ++PGYYDGRYWTMWKLP++GCTD+  VLKEV E +KEYP +F+RIIGFDN RQVQCISF+A KPP
Sbjct:   29 SSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPP 176          
BLAST of EY756460 vs. ExPASy Swiss-Prot
Match: RBS1A_ARATH (Ribulose bisphosphate carboxylase small chain 1A, chloroplastic OS=Arabidopsis thaliana GN=RBCS-1A PE=1 SV=2)

HSP 1 Score: 249.595 bits (636), Expect = 1.060e-65
Identity = 111/148 (75.00%), Postives = 129/148 (87.16%), Query Frame = 3
Query:   12 SSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATHVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 455
            SS+AFPAT+K NNDITSI SNGGRV CM+VWPP G KKFETLSYLP L+D  L KE+ YL+R+ WIPC+EFELE G+VYREH +SPGYYDGRYWTMWKLP++GCTD+  VLKEV E +KEYP++F+RIIGFDN RQVQCISF+A KPP
Sbjct:   29 SSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELAKEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKPP 176          
BLAST of EY756460 vs. ExPASy Swiss-Prot
Match: RBS_MEDSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 2.361e-65
Identity = 110/147 (74.83%), Postives = 128/147 (87.07%), Query Frame = 3
Query:   12 SSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATHVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 452
            SS+ FP TKKTNNDITSIASNGGRV CM+VWPP G KKFETLSYLPPL++E L KE+ YL+R GWIPCLEFELEKG+VYRE+H SPGYYDGRYWTMW+LP++G TD++ VLKE+ + + EYP SF+RIIGFDN RQVQCISF+A  P
Sbjct:   31 SSAGFPVTKKTNNDITSIASNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWIPCLEFELEKGFVYRENHRSPGYYDGRYWTMWRLPLFGATDSSQVLKELADCKAEYPDSFIRIIGFDNVRQVQCISFIAHTP 177          
BLAST of EY756460 vs. ExPASy Swiss-Prot
Match: RBS_FAGCR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Fagus crenata GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 2.361e-65
Identity = 113/148 (76.35%), Postives = 129/148 (87.16%), Query Frame = 3
Query:   12 SSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATHVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 455
            S++AFPAT+K+NNDITS+ASNGGRVQCMKVWPP GL+KFETLSYLPPLS E+L K+I YL+  GWIPCLEFELE  +VYRE++ SPGYYDGRYW MWKLPM+GCTDAT VL E+ E  K YP S +RIIGFDNKRQVQCISF+A KPP
Sbjct:   33 STAAFPATRKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSIESLAKQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSHIRIIGFDNKRQVQCISFIAYKPP 180          
BLAST of EY756460 vs. ExPASy Swiss-Prot
Match: RBS2B_ARATH (Ribulose bisphosphate carboxylase small chain 2B, chloroplastic OS=Arabidopsis thaliana GN=RBCS-2B PE=2 SV=2)

HSP 1 Score: 247.284 bits (630), Expect = 5.261e-65
Identity = 111/148 (75.00%), Postives = 127/148 (85.81%), Query Frame = 3
Query:   12 SSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATHVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 455
            SS++FP T+K NNDITSI SNGGRV CMKVWPP G KKFETLSYLP LSD  L KE+ YLLR+ WIPC+EFELE G+VYREH ++PGYYDGRYWTMWKLP++GCTD+  VLKEV E +KEYP +F+RIIGFDN RQVQCISF+A KPP
Sbjct:   29 SSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPP 176          
The following BLAST results are available for this feature:
BLAST of EY756460 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 127
Match NameE-valueIdentityDescription
RBS_LACSA8.380e-7178.67Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_BETVE3.295e-6778.00Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_PYRPY7.341e-6777.85Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_RAPSA8.116e-6676.35Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MALSP8.116e-6677.18Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS3B_ARATH1.060e-6576.35Ribulose bisphosphate carboxylase small chain 3B, ... [more]
RBS1A_ARATH1.060e-6575.00Ribulose bisphosphate carboxylase small chain 1A, ... [more]
RBS_MEDSA2.361e-6574.83Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_FAGCR2.361e-6576.35Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2B_ARATH5.261e-6575.00Ribulose bisphosphate carboxylase small chain 2B, ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-H03-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756460 ID=EY756460|Name=EY756460|organism=Citrus sinensis|type=EST|length=660bp
CCACGCGTCCGTCTTCTTCTGCTTTCCCAGCAACCAAGAAGACCAACAAT
GACATTACTTCCATTGCAAGCAACGGCGGAAGAGTCCAATGCATGAAGGT
GTGGCCACCAACTGGCTTGAAGAAGTTCGAGACTCTCTCATACCTCCCGC
CACTGTCCGATGAAGCTTTGCTCAAGGAAATCAGTTACCTTCTCCGCTCC
GGCTGGATTCCCTGCTTGGAATTCGAGTTGGAGAAAGGATGGGTGTACCG
TGAGCACCACAGCTCACCAGGATACTACGATGGACGCTACTGGACAATGT
GGAAGCTGCCCATGTATGGGTGCACAGATGCAACCCATGTTTTGAAGGAG
GTTGGGGAGGTCCAGAAGGAATACCCACATTCATTCGTCCGAATTATCGG
ATTTGACAACAAGCGTCAAGTGCAGTGCATCAGTTTCCTTGCTGCCAAGC
CACCAGGAGTCTAGGTTCCCAATTAAATTTGTGTAACCACCCATGCAATA
TTGTTGATTATTATTATGTGGAACCCCCATAATGATCATTCGATCAAAGA
GGGTTCGGACTGCGTTTAATTTGTACTTAAGCTGCTGNTGCTGCTGCTCA
AACTTTGTTGGGTTTCNNCCCGCCGNGTAGATCTTCANTTTATAATTGTG
GCTTAAAAAA
back to top