EY756459

Overview
NameEY756459
Unique NameEY756459
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length882
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756459 vs. ExPASy Swiss-Prot
Match: ACSL4_HUMAN (Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens GN=ACSL4 PE=1 SV=2)

HSP 1 Score: 214.927 bits (546), Expect = 3.802e-58
Identity = 111/220 (50.45%), Postives = 143/220 (65.00%), Query Frame = 2
Query:   26 GVMMTHGNVLATVSAVMTIVPDLGSKDVYLAYLPLAHVLELAAENLIAGVGSAIGYGTPLTLTDTSSKIKRGTQGDASVLRPTVMASVPAILDRVRDGVRKKVDAKGGLSKKLFDLAYARRLSAINGSWFGAWGLEKLLWNLLVFSKARAILGGRIRFILSGGAPLSADTQRSINICLGAPIGQGYGLTETCAGGTFSEVDDSSXGRVGAPLPCSFINYR 685
            GVMM H N++A ++     +P LG KD Y+ YLPLAHVLEL AE      G  IGY +PLTL+D SSKIK+G++GD +VL+PT+MA+VP I+DR+   V  KV     + K LF + Y  +L  I        G +  L NLL+F K +A+LGG +R +LSGGAPLS  T R +N+C   PIGQGYGLTE+C  GT +EV D + GRVGAPL C  I  +
Sbjct:  287 GVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKK------GYDAPLCNLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLK 500          

HSP 2 Score: 30.0314 bits (66), Expect = 3.802e-58
Identity = 19/36 (52.78%), Postives = 22/36 (61.11%), Query Frame = 3
Query:  684 DWPEGGI*LVI-PNARGEIVIAGQ-MSSWVFKMKTK 785
            DW EGG  +   PN RGEIVI GQ +S   FK + K
Sbjct:  501 DWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEK 536          
BLAST of EY756459 vs. ExPASy Swiss-Prot
Match: ACSL4_RAT (Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norvegicus GN=Acsl4 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 8.429e-58
Identity = 110/220 (50.00%), Postives = 143/220 (65.00%), Query Frame = 2
Query:   26 GVMMTHGNVLATVSAVMTIVPDLGSKDVYLAYLPLAHVLELAAENLIAGVGSAIGYGTPLTLTDTSSKIKRGTQGDASVLRPTVMASVPAILDRVRDGVRKKVDAKGGLSKKLFDLAYARRLSAINGSWFGAWGLEKLLWNLLVFSKARAILGGRIRFILSGGAPLSADTQRSINICLGAPIGQGYGLTETCAGGTFSEVDDSSXGRVGAPLPCSFINYR 685
            GVMM H N++A ++     +P LG KD Y+ YLPLAHVLEL AE      G  IGY +PLTL+D SSKIK+G++GD +VL+PT+MA+VP I+DR+   V  KV     + K LF + Y  +L  I        G +  L NL++F K +A+LGG +R +LSGGAPLS  T R +N+C   PIGQGYGLTE+C  GT +EV D + GRVGAPL C  I  +
Sbjct:  246 GVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKK------GYDAPLCNLILFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLK 459          

HSP 2 Score: 29.6462 bits (65), Expect = 8.429e-58
Identity = 19/36 (52.78%), Postives = 22/36 (61.11%), Query Frame = 3
Query:  684 DWPEGGI*LVI-PNARGEIVIAGQ-MSSWVFKMKTK 785
            DW EGG  +   PN RGEIVI GQ +S   FK + K
Sbjct:  460 DWQEGGYTVHDKPNPRGEIVIGGQNISMGYFKNEEK 495          
BLAST of EY756459 vs. ExPASy Swiss-Prot
Match: ACSL4_MOUSE (Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculus GN=Acsl4 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 7.650e-56
Identity = 107/220 (48.64%), Postives = 142/220 (64.55%), Query Frame = 2
Query:   26 GVMMTHGNVLATVSAVMTIVPDLGSKDVYLAYLPLAHVLELAAENLIAGVGSAIGYGTPLTLTDTSSKIKRGTQGDASVLRPTVMASVPAILDRVRDGVRKKVDAKGGLSKKLFDLAYARRLSAINGSWFGAWGLEKLLWNLLVFSKARAILGGRIRFILSGGAPLSADTQRSINICLGAPIGQGYGLTETCAGGTFSEVDDSSXGRVGAPLPCSFINYR 685
            G+MM H N++A ++     +P LG KD Y+ YLPLAHVLEL AE      G  IGY +PLTL+D SSKIK+G++GD +VL+PT+MA+VP I+DR+   V  KV     + K LF + Y  +L  I        G +  L NL++F K + ++GG +R +L GGAPLS  T R +N+CL  PIGQGYGLTE+C  GT +EV D + GRVGAPL C  I  +
Sbjct:  287 GLMMHHTNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYVQKTLFKIGYDYKLEQIKK------GYDAPLCNLILFKKVKDLVGGNVRMMLYGGAPLSPQTHRFMNVCLCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLK 500          

HSP 2 Score: 29.6462 bits (65), Expect = 7.650e-56
Identity = 19/36 (52.78%), Postives = 22/36 (61.11%), Query Frame = 3
Query:  684 DWPEGGI*LVI-PNARGEIVIAGQ-MSSWVFKMKTK 785
            DW EGG  +   PN RGEIVI GQ +S   FK + K
Sbjct:  501 DWQEGGYTVHDKPNPRGEIVIGGQNISMGYFKNEEK 536          
BLAST of EY756459 vs. ExPASy Swiss-Prot
Match: ACSL3_PONAB (Long-chain-fatty-acid--CoA ligase 3 OS=Pongo abelii GN=ACSL3 PE=2 SV=2)

HSP 1 Score: 214.542 bits (545), Expect = 6.231e-55
Identity = 127/289 (43.94%), Postives = 172/289 (59.52%), Query Frame = 2
Query:   26 GVMMTHGNVLATVSAVMTIVPDLGSKDVYLAYLPLAHVLELAAENLIAGVGSAIGYGTPLTLTDTSSKIKRGTQGDASVLRPTVMASVPAILDRVRDGVRKKVDAKGGLSKKLFDLAYARRLSAINGSWFGAWGLEKLLWNLLVFSKARAILGGRIRFILSGGAPLSADTQRSINICLGAPIGQGYGLTETCAGGTFSEVDDSSXGRVGAPLPCSFINYRLA*RW----YLTSDSQCTWGNSHCWSN-VQLG-IQNEDKTRA--YKLMTKDEWVYSG-IVDRSAEGSLK 865
            GVM++H N++A ++ +   +P+LG +DVY+ YLPLAHVLEL+AE +    G  IGY +P TL D SSKIK+G++GD S+L+PT+MA+VP I+DR+   V  KV       + LF LAY  ++  I+       G    L N  VF K R++LGG IR +L GGAPLSA TQR +NIC   P+GQGYGLTE+   GT SEV D + GRVGAPL C  I  +    W    Y  +D     G        V +G  +NE KT+A  ++      W+ +G I +   +G LK
Sbjct:  296 GVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISK------GRNTPLCNSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLK---NWEEGGYFNTDKPHPRGEILIGGQIVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLK 575          
BLAST of EY756459 vs. ExPASy Swiss-Prot
Match: ACSL3_HUMAN (Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens GN=ACSL3 PE=1 SV=3)

HSP 1 Score: 213.001 bits (541), Expect = 1.813e-54
Identity = 126/289 (43.60%), Postives = 173/289 (59.86%), Query Frame = 2
Query:   26 GVMMTHGNVLATVSAVMTIVPDLGSKDVYLAYLPLAHVLELAAENLIAGVGSAIGYGTPLTLTDTSSKIKRGTQGDASVLRPTVMASVPAILDRVRDGVRKKVDAKGGLSKKLFDLAYARRLSAINGSWFGAWGLEKLLWNLLVFSKARAILGGRIRFILSGGAPLSADTQRSINICLGAPIGQGYGLTETCAGGTFSEVDDSSXGRVGAPLPCSFINYRLA*RW----YLTSDSQCTWGNSHC-WSNVQLG-IQNEDKTRA--YKLMTKDEWVYSG-IVDRSAEGSLK 865
            GVM++H N++A ++ +   +P+LG +DVY+ YLPLAHVLEL+AE +    G  IGY +P TL D SSKIK+G++GD S+L+PT+MA+VP I+DR+   V  KV       + LF LAY  ++  I+       G    L +  VF K R++LGG IR +L GGAPLSA TQR +NIC   P+GQGYGLTE+   GT SEV D + GRVGAPL C  I  +    W    Y  +D     G       +V +G  +NE KT+A  ++      W+ +G I +   +G LK
Sbjct:  296 GVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISK------GRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLK---NWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLK 575          
BLAST of EY756459 vs. ExPASy Swiss-Prot
Match: ACSL3_RAT (Long-chain-fatty-acid--CoA ligase 3 OS=Rattus norvegicus GN=Acsl3 PE=1 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 4.039e-54
Identity = 126/289 (43.60%), Postives = 172/289 (59.52%), Query Frame = 2
Query:   26 GVMMTHGNVLATVSAVMTIVPDLGSKDVYLAYLPLAHVLELAAENLIAGVGSAIGYGTPLTLTDTSSKIKRGTQGDASVLRPTVMASVPAILDRVRDGVRKKVDAKGGLSKKLFDLAYARRLSAINGSWFGAWGLEKLLWNLLVFSKARAILGGRIRFILSGGAPLSADTQRSINICLGAPIGQGYGLTETCAGGTFSEVDDSSXGRVGAPLPCSFINYRLA*RW----YLTSDSQCTWGNSHC-WSNVQLG-IQNEDKTRA--YKLMTKDEWVYSG-IVDRSAEGSLK 865
            GVM++H N++A+++ +   +P LG +DVY+ YLPLAHVLEL+AE +    G  IGY +P TL D SSKIK+G++GD SVL+PT+MA+VP I+DR+   V  KV+      + LF LAY  ++  I+       G    L +  VF   R +LGG IR +L GGAPLSA TQR +NIC   P+GQGYGLTE+   GT +EV D + GRVGAPL C  I  +    W    Y  +D     G       NV +G  +NE KT+A  ++      W+ +G I +   +G LK
Sbjct:  296 GVMISHSNIIASITGMARRIPRLGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSVLKPTLMAAVPEIMDRIYKNVMNKVNEMSAFQRNLFILAYNYKMEQISK------GCSTPLCDRFVFRNVRRLLGGNIRVLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESTGAGTITEVWDYNTGRVGAPLVCCEIKLK---NWEEGGYFNTDKPHPRGEILIGGQNVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFDPDGCLK 575          
BLAST of EY756459 vs. ExPASy Swiss-Prot
Match: ACSL3_MOUSE (Long-chain-fatty-acid--CoA ligase 3 OS=Mus musculus GN=Acsl3 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 8.997e-54
Identity = 125/289 (43.25%), Postives = 171/289 (59.17%), Query Frame = 2
Query:   26 GVMMTHGNVLATVSAVMTIVPDLGSKDVYLAYLPLAHVLELAAENLIAGVGSAIGYGTPLTLTDTSSKIKRGTQGDASVLRPTVMASVPAILDRVRDGVRKKVDAKGGLSKKLFDLAYARRLSAINGSWFGAWGLEKLLWNLLVFSKARAILGGRIRFILSGGAPLSADTQRSINICLGAPIGQGYGLTETCAGGTFSEVDDSSXGRVGAPLPCSFINYRLA*RW----YLTSDSQCTWGNSHC-WSNVQLG-IQNEDKTRA--YKLMTKDEWVYSG-IVDRSAEGSLK 865
            GVM++H N++A+++ +   +P LG +DVY+ YLPLAHVLEL+AE +    G  IGY +P TL D SSKIK+G++GD SVL+PT+MA+VP I+DR+   V  KV+      + LF LAY  ++  I+       G    L +  VF   R +LGG IR +L GGAPLSA TQR +NIC   P+GQGYGLTE+   GT +EV D + GRVGAPL C  I  +    W    Y  +D     G       NV +G  +NE KT+   ++      W+ +G I +   +G LK
Sbjct:  296 GVMISHSNIIASITGMARRIPRLGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSVLKPTLMAAVPEIMDRIYKNVMNKVNEMSAFQRNLFILAYNYKMEQISK------GCSTPLCDRFVFRNVRRLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESTGAGTITEVWDYNTGRVGAPLVCCEIKLK---NWEEGGYFNTDKPHPRGEILIGGQNVTMGYYKNEAKTKTDFFEDENGQRWLCTGDIGEFDPDGCLK 575          
BLAST of EY756459 vs. ExPASy Swiss-Prot
Match: LCF1_SCHPO (Long-chain-fatty-acid--CoA ligase 1 OS=Schizosaccharomyces pombe GN=lcf1 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 3.930e-33
Identity = 87/221 (39.37%), Postives = 130/221 (58.82%), Query Frame = 2
Query:   26 GVMMTHGNVLATVSAVMTIVPDLGSKDVYLAYLPLAHVLELAAENLIAGVGSAIGYGTPLTLTDTSSKIKRGTQGDASVLRPTVMASVPAILDRVRDGVRKKVDAKGGLSKKLFDLAYARRLSAINGSWFGAWGLEKLLWNLLVFSKARAI-LGGRIRFILSGGAPLSADTQRSINICLGAPIGQGYGLTETCAGGTFS-----EVDDSSXGRVGAPLPCS 670
            GV+++H N++A V+A++  VP++ SKD  LAYLPLAH+LE A EN+    G  IGY    TL DT+    R  +GD +  RPT+M  VPA+ + VR G+  K++A   + + +F  AY  +   +  +  G+  L+       VF+K R++  GGR+R+ LSGG+ LS DT+R ++I L  P+  GYGLTE  A           +DDS+    G+ LPC+
Sbjct:  256 GVILSHKNMVAIVTAIVKHVPEVTSKDYLLAYLPLAHILEFAFENICLAWGGTIGYANVRTLVDTNC---RNCKGDINTFRPTIMVGVPAVWEMVRKGIMSKLNAASAVKRSVFWTAYYTKAKLMRHNLPGSCVLD-----TAVFNKIRSMGTGGRLRYTLSGGSALSPDTKRFLSIVL-CPMLIGYGLTEISAAAMVQNPACFNLDDSA----GSLLPCT 463          
BLAST of EY756459 vs. ExPASy Swiss-Prot
Match: LCF2_SCHPO (Long-chain-fatty-acid--CoA ligase 2 OS=Schizosaccharomyces pombe GN=SPBP4H10.11c PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.308e-28
Identity = 93/285 (32.63%), Postives = 141/285 (49.47%), Query Frame = 2
Query:   26 GVMMTHGNVLATVSAVMTIVPD-LGSKDVYLAYLPLAHVLELAAENLIAGVGSAIGYGTPLTLTDTSSKIKRGTQGDASVLRPTVMASVPAILDRVRDGVRKKVDAKGGLSKKLFDLAYARRLSAINGSWFGAWGLEKLLWNLLVFSKARAILGGRIRFILSGGAPLSADTQRSINICLGAPIGQGYGLTETCAGGTFSEVDD--SSXGRVGAPLP-CSFINYRLA*RWYLTSDSQC---TWGNSHCWSNVQLGIQNEDKTRAYKLMTKDEWVYSGIVDRSAEGS 859
            GV++ H N++A +  +  I+   +  KD  LAYLPLAH+ E   E      G  +GY +P TLTD S       +GD +  RPTV+  VPA+ + ++ G+  KV +     +K+F  + + +   I  +  G+  L+      +VF+K +A  GGR+R+ +SGGA L+A TQ  ++ C+  P+  GYGLTETCAG      +        VG P+P   F    +    Y T  S      W       N  L  + ED   A+   T+D W  +G V   A+G+
Sbjct:  262 GVVLLHRNIIAALGGINRILSQHINVKDYVLAYLPLAHIFEFIFEMCCLYWGGVLGYASPRTLTDASVV---NCKGDLTEFRPTVLIGVPAVYELIKKGILAKVSSMPAHRQKVFSGSLSLKQYLIERNLPGSAALD-----AIVFNKVKAATGGRLRYCISGGAALAASTQAFLSSCI-CPVLPGYGLTETCAGSFVLSPEQWHLYANTVGFPIPSIEFKLVDIPDLGYYTDSSPPRGEVWIRGPAVCNGYLN-RPEDNKAAF---TEDGWFKTGDVGEIAKGN 533          
BLAST of EY756459 vs. ExPASy Swiss-Prot
Match: LCF1_YEAST (Long-chain-fatty-acid--CoA ligase 1 OS=Saccharomyces cerevisiae GN=FAA1 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.108e-27
Identity = 80/215 (37.21%), Postives = 115/215 (53.49%), Query Frame = 2
Query:   26 GVMMTHGNVLATVS-AVMTIVPDLGSKDVYLAYLPLAHVLELAAENLIAGVGSAIGYGTPLTLTDTSSKIKRGTQGDASVLRPTVMASVPAILDRVRDGVRKKVDAKGGLSKKLFDLAYARRLSAINGSWFGAWGLEKLLWNLLVFSKARAILGGRIRFILSGGAPLSADTQRSINICLGAPIGQGYGLTETCAGGTFSEVDDSSXGRVGAPLPC 667
            GV++ H NV+A V  A + ++  +G+ D  + +LPLAH+ EL  E L    G+ IGY T  TLT +S    R  QGD    +PT+M  V A+ + VR G+  ++D    L+KK+F  AY  +L+       G   L       LVF K R   GG++R++L+GG+P+S D Q  I   +  P+  GYGLTETCA  T  +  +   G  G    C
Sbjct:  279 GVVLKHSNVVAGVGGASLNVLKFVGNTDRVICFLPLAHIFELVFELLSFYWGACIGYATVKTLTSSSV---RNCQGDLQEFKPTIMVGVAAVWETVRKGILNQIDNLPFLTKKIFWTAYNTKLNMQRLHIPGGGALGN-----LVFKKIRTATGGQLRYLLNGGSPISRDAQEFITNLI-CPMLIGYGLTETCASTTILDPANFELGVAGDLTGC 484          
The following BLAST results are available for this feature:
BLAST of EY756459 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
ACSL4_HUMAN3.802e-5850.45Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapien... [more]
ACSL4_RAT8.429e-5850.00Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norv... [more]
ACSL4_MOUSE7.650e-5648.64Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculu... [more]
ACSL3_PONAB6.231e-5543.94Long-chain-fatty-acid--CoA ligase 3 OS=Pongo abeli... [more]
ACSL3_HUMAN1.813e-5443.60Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapien... [more]
ACSL3_RAT4.039e-5443.60Long-chain-fatty-acid--CoA ligase 3 OS=Rattus norv... [more]
ACSL3_MOUSE8.997e-5443.25Long-chain-fatty-acid--CoA ligase 3 OS=Mus musculu... [more]
LCF1_SCHPO3.930e-3339.37Long-chain-fatty-acid--CoA ligase 1 OS=Schizosacch... [more]
LCF2_SCHPO1.308e-2832.63Long-chain-fatty-acid--CoA ligase 2 OS=Schizosacch... [more]
LCF1_YEAST1.108e-2737.21Long-chain-fatty-acid--CoA ligase 1 OS=Saccharomyc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-H02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756459 ID=EY756459|Name=EY756459|organism=Citrus sinensis|type=EST|length=882bp
CCACGCGTCCGACTGGTTTTTCCCGGGTGTAATGATGACACATGGCAATG
TCTTAGCCACAGTTTCTGCAGTCATGACAATCGTTCCTGACCTGGGAAGC
AAGGATGTTTATTTGGCATACCTACCTCTGGCTCATGTTCTGGAATTAGC
AGCTGAGAACCTAATTGCTGGTGTTGGAAGCGCAATAGGATATGGTACCC
CTTTGACTCTCACTGATACCTCAAGCAAAATAAAAAGGGGTACCCAGGGG
GATGCATCTGTTTTGAGGCCAACTGTGATGGCCTCTGTCCCAGCAATACT
CGACCGTGTTCGAGATGGTGTACGCAAGAAAGTAGATGCAAAAGGTGGAC
TTTCCAAGAAATTGTTTGACTTGGCATATGCTCGCAGACTGTCTGCAATA
AATGGTAGCTGGTTTGGGGCATGGGGCCTGGAAAAACTTTTGTGGAACCT
CCTTGTGTTTTCGAAAGCTCGTGCAATTCTAGGAGGTCGGATCCGGTTTA
TACTTTCTGGAGGTGCTCCACTTTCTGCTGATACTCAAAGATCTATCAAC
ATTTGCCTTGGTGCTCCAATAGGGCAAGGGTATGGGCTTACTGAGACGTG
TGCTGGGGGTACCTTTTCTGAGGTGGATGATTCATCTGNTGGTCGTGTCG
GNGCTCCACTTCCTTGCTCATTCATTAATTATAGACTGGCCTGAAGGTGG
TATTTAACTAGTGATTCCCAATGCACGTGGGGAAATAGTCATTGCTGGTC
AAATGTCCAGTTGGGTATTCAAAATGAAGACAAAACTAGAGCGTACAAGT
TGATGACAAAGGATGAGTGGGTCTATTCGGGGATCGTGGACCGGTCTGCT
GAAGGTTCCTTAAAAAATGGACGAAAAAGACA
back to top