EY756458

Overview
NameEY756458
Unique NameEY756458
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length732
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY756458_ssr546 microsatellite EY756458_ssr546:546..557. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY756458 vs. ExPASy Swiss-Prot
Match: FER2_ARATH (Ferredoxin-2, chloroplastic OS=Arabidopsis thaliana GN=FD2 PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 4.152e-48
Identity = 93/143 (65.03%), Postives = 111/143 (77.62%), Query Frame = 3
Query:   78 ALSSAMVSTSFIRNKPTVTSLKAMPNMG-QALFGLKANNNRGGRVIAMATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKXXXXXXXXXXXXFLEDDQIDAGYVLTCVAYPTSDVTVETHKDEEM 503
            ALSSA+V TSFIR  P   SL+++P+   Q+LFGLK+   RGGRV AMATYKVK ITPEGE E+EC DD Y+LDAAE+AGIDLPYSCRAGSCS+CAGK            FL+D+QI  G+VLTC AYPTSDVT+ETHK+E++
Sbjct:    5 ALSSAIVGTSFIRRSPAPISLRSLPSANTQSLFGLKSGTARGGRVTAMATYKVKFITPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEDI 147          
BLAST of EY756458 vs. ExPASy Swiss-Prot
Match: FER1_ARATH (Ferredoxin-1, chloroplastic OS=Arabidopsis thaliana GN=FD1 PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.208e-47
Identity = 92/141 (65.25%), Postives = 112/141 (79.43%), Query Frame = 3
Query:   78 ALSSAMVSTSFIRNKPTVTSLKAMPNMG-QALFGLKANNNRGGRVIAMATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKXXXXXXXXXXXXFLEDDQIDAGYVLTCVAYPTSDVTVETHKDE 497
            ALSSA+VSTSF+R + T  SL+++P    Q+LFGLK++  RGGRV AMATYKVK ITPEGEQE+EC +D Y+LDAAE+AG+DLPYSCRAGSCS+CAGK            FL+D+Q+  GYVLTCVAYPTSDV +ETHK+E
Sbjct:    5 ALSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFITPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDVVIETHKEE 145          
BLAST of EY756458 vs. ExPASy Swiss-Prot
Match: FER_CAPAN (Ferredoxin, chloroplastic OS=Capsicum annuum GN=AP1 PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.515e-47
Identity = 90/144 (62.50%), Postives = 113/144 (78.47%), Query Frame = 3
Query:   72 MAALSSAMVSTSFIRNKPTVTSLKAMPNMGQALFGLKANNNRGGRVIAMATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKXXXXXXXXXXXXFLEDDQIDAGYVLTCVAYPTSDVTVETHKDEEM 503
            MA++S+ M+STSF+  KP VTSLK +PN+G+ALFGLK+ N  GG+V  MA+YKVKLITP+G  E +CPD+ YILD AE+AG DLPYSCRAGSCS+CAGK            FL+DDQ++ G+VLTCVAYP SDVT+ETHK+ E+
Sbjct:    1 MASVSATMISTSFMPRKPAVTSLKPIPNVGEALFGLKSAN--GGKVTCMASYKVKLITPDGPIEFDCPDNVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTDGNFLDDDQLEEGWVLTCVAYPQSDVTIETHKEAEL 142          
BLAST of EY756458 vs. ExPASy Swiss-Prot
Match: FER1_SOLLC (Ferredoxin-1, chloroplastic OS=Solanum lycopersicum GN=SEND33 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 5.995e-47
Identity = 91/145 (62.76%), Postives = 110/145 (75.86%), Query Frame = 3
Query:   72 MAALSSAMVSTSFIRNKPTVTSLKAMPNMGQALFGLKANNNRGGRVIAMATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKXXXXXXXXXXXXFLEDDQIDAGYVLTCVAYPTSDVTVETHKDEEMS 506
            MA++S  M+STSF+  KP VTSLKA+ N+G+ALFGLK+  N  GR+  MA+YKVKLITPEG  E ECPDD YILD AE+ G DLPYSCRAGSCS+CAGK            FL++DQ  AG+VLTCVAYP  DVT+ETHK+EE++
Sbjct:    1 MASISGTMISTSFLPRKPAVTSLKAISNVGEALFGLKSGRN--GRITCMASYKVKLITPEGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGSVDQSDGNFLDEDQEAAGFVLTCVAYPKGDVTIETHKEEELT 143          
BLAST of EY756458 vs. ExPASy Swiss-Prot
Match: FER1_MESCR (Ferredoxin-1, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.886e-46
Identity = 94/147 (63.95%), Postives = 115/147 (78.23%), Query Frame = 3
Query:   69 TMAALSSAMVSTSFIRNKPTVTSLKAMP-NMGQALFGLKANNNRGGRVIAMATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKXXXXXXXXXXXXFLEDDQIDAGYVLTCVAYPTSDVTVETHKDEEMS 506
            T AALS A +ST+F    P +T+  A+P N+G+ALFGLK++ +RG RV AMA YKV L+TPEG+QE+ECPDD YILDAAE+AGIDLPYSCRAGSCS+CAGK            FL+DDQI  G+VLTCVAYPT DVT+ETHK+EE++
Sbjct:    4 TTAALSGATMSTAFAPKTPPMTA--ALPTNVGRALFGLKSSASRG-RVTAMAAYKVTLVTPEGKQELECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVTSGSVNQDDGSFLDDDQIKEGWVLTCVAYPTGDVTIETHKEEELT 147          
BLAST of EY756458 vs. ExPASy Swiss-Prot
Match: FER1_PEA (Ferredoxin-1, chloroplastic OS=Pisum sativum GN=PETF PE=1 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 7.584e-42
Identity = 81/146 (55.48%), Postives = 100/146 (68.49%), Query Frame = 3
Query:   69 TMAALSSAMVSTSFIRNKPTVTSLKAMPNMGQALFGLKANNNRGGRVIAMATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKXXXXXXXXXXXXFLEDDQIDAGYVLTCVAYPTSDVTVETHKDEEMS 506
            T  AL    VSTSF+R +P   S+           GLK +  RG   +AMA+YKVKL+TP+G QE ECP D YILD AE+ GIDLPYSCRAGSCS+CAGK            FL+D+QI+AG+VLTCVAYPTSDV +ETHK+E+++
Sbjct:    3 TTPALYGTAVSTSFLRTQPMPMSVTTTKAFSNGFLGLKTSLKRGDLAVAMASYKVKLVTPDGTQEFECPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDDEQIEAGFVLTCVAYPTSDVVIETHKEEDLT 148          
BLAST of EY756458 vs. ExPASy Swiss-Prot
Match: FER1_SPIOL (Ferredoxin-1, chloroplastic OS=Spinacia oleracea GN=PETF PE=1 SV=2)

HSP 1 Score: 162.155 bits (409), Expect = 2.697e-39
Identity = 83/148 (56.08%), Postives = 105/148 (70.95%), Query Frame = 3
Query:   72 MAALSSAMV--STSFIRNKPTVTSLKAMP-NMGQALFGLKANNNRGGRVIAMATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKXXXXXXXXXXXXFLEDDQIDAGYVLTCVAYPTSDVTVETHKDEEMS 506
            MAA ++ M+  +T+F+        + A+P N G++LFGLK  + RGGR+  MA YKV L+TP G  E +CPDD YILDAAE+ GIDLPYSCRAGSCS+CAGK            FL+DDQID G+VLTC AYP SDVT+ETHK+EE++
Sbjct:    1 MAATTTTMMGMATTFVPKPQAPPMMAALPSNTGRSLFGLKTGS-RGGRM-TMAAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEELT 146          
BLAST of EY756458 vs. ExPASy Swiss-Prot
Match: FER_SILPR (Ferredoxin, chloroplastic OS=Silene pratensis GN=PETF PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.523e-39
Identity = 82/145 (56.55%), Postives = 102/145 (70.34%), Query Frame = 3
Query:   75 AALSSAMVSTSFIRNKPTVTSLKAMPNMGQALFGLKANNNRGGRVIAMATYKVKLITPE-GEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKXXXXXXXXXXXXFLEDDQIDAGYVLTCVAYPTSDVTVETHKDEEMS 506
            + LS+  VS S +  +  + +     NMGQALFGLKA +   GRV AMATYKV LIT E G    +CPDD Y+LD AE+ GIDLPYSCRAGSCS+CAGK            FL+DDQI+AG+VLTC AYP++DVT+ETHK+EE++
Sbjct:    3 STLSTLSVSASLLPKQQPMVASSLPTNMGQALFGLKAGSR--GRVTAMATYKVTLITKESGTVTFDCPDDVYVLDQAEEEGIDLPYSCRAGSCSSCAGKVVAGSVDQSDQSFLDDDQIEAGWVLTCAAYPSADVTIETHKEEELT 145          
BLAST of EY756458 vs. ExPASy Swiss-Prot
Match: FER_SYNY4 (Ferredoxin OS=Synechocystis sp. (strain PCC 6714) PE=1 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 2.363e-35
Identity = 68/96 (70.83%), Postives = 79/96 (82.29%), Query Frame = 3
Query:  216 MATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKXXXXXXXXXXXXFLEDDQIDAGYVLTCVAYPTSDVTVETHKDEEM 503
            MA+Y VKLITP+GE  IEC DDTYILDAAE+AG+DLPYSCRAG+CSTCAGK            FL+DDQI+AGYVLTCVAYPTSD T+ETHK+E++
Sbjct:    1 MASYTVKLITPDGENSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDL 96          
BLAST of EY756458 vs. ExPASy Swiss-Prot
Match: FER_SYNY3 (Ferredoxin-1 OS=Synechocystis sp. (strain PCC 6803) GN=petF PE=1 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 2.363e-35
Identity = 68/96 (70.83%), Postives = 79/96 (82.29%), Query Frame = 3
Query:  216 MATYKVKLITPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKXXXXXXXXXXXXFLEDDQIDAGYVLTCVAYPTSDVTVETHKDEEM 503
            MA+Y VKLITP+GE  IEC DDTYILDAAE+AG+DLPYSCRAG+CSTCAGK            FL+DDQI+AGYVLTCVAYPTSD T+ETHK+E++
Sbjct:    1 MASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDL 96          
The following BLAST results are available for this feature:
BLAST of EY756458 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 109
Match NameE-valueIdentityDescription
FER2_ARATH4.152e-4865.03Ferredoxin-2, chloroplastic OS=Arabidopsis thalian... [more]
FER1_ARATH1.208e-4765.25Ferredoxin-1, chloroplastic OS=Arabidopsis thalian... [more]
FER_CAPAN3.515e-4762.50Ferredoxin, chloroplastic OS=Capsicum annuum GN=AP... [more]
FER1_SOLLC5.995e-4762.76Ferredoxin-1, chloroplastic OS=Solanum lycopersicu... [more]
FER1_MESCR3.886e-4663.95Ferredoxin-1, chloroplastic OS=Mesembryanthemum cr... [more]
FER1_PEA7.584e-4255.48Ferredoxin-1, chloroplastic OS=Pisum sativum GN=PE... [more]
FER1_SPIOL2.697e-3956.08Ferredoxin-1, chloroplastic OS=Spinacia oleracea G... [more]
FER_SILPR3.523e-3956.55Ferredoxin, chloroplastic OS=Silene pratensis GN=P... [more]
FER_SYNY42.363e-3570.83Ferredoxin OS=Synechocystis sp. (strain PCC 6714) ... [more]
FER_SYNY32.363e-3570.83Ferredoxin-1 OS=Synechocystis sp. (strain PCC 6803... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-H01-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756458 ID=EY756458|Name=EY756458|organism=Citrus sinensis|type=EST|length=732bp
CCACGCGTCCGGGTCACCAATTCTCTCTCTAGCTTCACATTCAGACACTC
AGAAAGCAACAGAAAATAACAATGGCCGCGCTCTCAAGCGCCATGGTCAG
CACCTCATTCATCAGAAACAAGCCAACAGTGACAAGCCTCAAGGCCATGC
CCAACATGGGTCAGGCTTTGTTTGGCCTTAAAGCCAACAACAACAGAGGT
GGACGTGTAATAGCCATGGCTACATACAAAGTCAAGCTCATTACACCCGA
GGGAGAGCAAGAAATTGAGTGTCCTGATGACACATATATTCTTGATGCAG
CTGAAGATGCTGGAATTGATCTCCCATATTCATGCAGGGCTGGTTCTTGC
TCTACTTGTGCTGGGAAAGTTGTCTCTGGTAGTGTTGACCAGTCAGATGG
AAGCTTTCTTGAGGATGATCAAATAGATGCAGGTTATGTTCTCACTTGTG
TTGCTTATCCTACAAGTGATGTTACTGTTGAGACACACAAGGATGAAGAA
ATGTCTTAATTATGCGGCGCTTTAATATAACATGGAGAATTTTGATATTA
TTATTATTAATATTGTGTATGGTTTGGTAATTTAGTGCCTTGTAAGGGGA
AATGTTGAATATTGACGTGCTTTCTTGAATGAGTAATATGAAAAGGGGGG
GATTTGCTCTGTACTTCCCATTGCTGTCACAAATGAAGNTGTTGTAGCTT
TACAATATAAAGATAGAATCATCTCTTTCTAT
back to top