EY756456

Overview
NameEY756456
Unique NameEY756456
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length868
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756456 vs. ExPASy Swiss-Prot
Match: YTHD1_MOUSE (YTH domain family protein 1 OS=Mus musculus GN=Ythdf1 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.588e-13
Identity = 38/77 (49.35%), Postives = 46/77 (59.74%), Query Frame = 1
Query:   13 QDNCNGYFPVKWHIIKDVPNPQLRHIILENNGATPLTNTRYPPEVKFPQGIEILNIFKNYRSKTSILDDCDFYESPQ 243
            QD   G F VKW  +KDVPN QLRHI LENN   P+TN+R   EV   +  ++L I  +Y+  TSI DD   YE  Q
Sbjct:  467 QDKWKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 543          
BLAST of EY756456 vs. ExPASy Swiss-Prot
Match: YTHD2_MACFA (YTH domain family protein 2 OS=Macaca fascicularis GN=YTHDF2 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.767e-13
Identity = 37/77 (48.05%), Postives = 46/77 (59.74%), Query Frame = 1
Query:   13 QDNCNGYFPVKWHIIKDVPNPQLRHIILENNGATPLTNTRYPPEVKFPQGIEILNIFKNYRSKTSILDDCDFYESPQ 243
            QD   G F V+W  +KDVPN QLRHI LENN   P+TN+R   EV   +  ++L I  +Y+  TSI DD   YE  Q
Sbjct:  488 QDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 564          
BLAST of EY756456 vs. ExPASy Swiss-Prot
Match: YTHD2_HUMAN (YTH domain family protein 2 OS=Homo sapiens GN=YTHDF2 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 5.767e-13
Identity = 37/77 (48.05%), Postives = 46/77 (59.74%), Query Frame = 1
Query:   13 QDNCNGYFPVKWHIIKDVPNPQLRHIILENNGATPLTNTRYPPEVKFPQGIEILNIFKNYRSKTSILDDCDFYESPQ 243
            QD   G F V+W  +KDVPN QLRHI LENN   P+TN+R   EV   +  ++L I  +Y+  TSI DD   YE  Q
Sbjct:  488 QDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 564          
BLAST of EY756456 vs. ExPASy Swiss-Prot
Match: YTHD2_BOVIN (YTH domain family protein 2 OS=Bos taurus GN=YTHDF2 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.767e-13
Identity = 37/77 (48.05%), Postives = 46/77 (59.74%), Query Frame = 1
Query:   13 QDNCNGYFPVKWHIIKDVPNPQLRHIILENNGATPLTNTRYPPEVKFPQGIEILNIFKNYRSKTSILDDCDFYESPQ 243
            QD   G F V+W  +KDVPN QLRHI LENN   P+TN+R   EV   +  ++L I  +Y+  TSI DD   YE  Q
Sbjct:  489 QDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 565          
BLAST of EY756456 vs. ExPASy Swiss-Prot
Match: YTHD1_HUMAN (YTH domain family protein 1 OS=Homo sapiens GN=YTHDF1 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 9.836e-13
Identity = 37/77 (48.05%), Postives = 46/77 (59.74%), Query Frame = 1
Query:   13 QDNCNGYFPVKWHIIKDVPNPQLRHIILENNGATPLTNTRYPPEVKFPQGIEILNIFKNYRSKTSILDDCDFYESPQ 243
            QD   G F V+W  +KDVPN QLRHI LENN   P+TN+R   EV   +  ++L I  +Y+  TSI DD   YE  Q
Sbjct:  467 QDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQ 543          
BLAST of EY756456 vs. ExPASy Swiss-Prot
Match: YTHD3_PONAB (YTH domain family protein 3 OS=Pongo abelii GN=YTHDF3 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.678e-12
Identity = 37/77 (48.05%), Postives = 45/77 (58.44%), Query Frame = 1
Query:   13 QDNCNGYFPVKWHIIKDVPNPQLRHIILENNGATPLTNTRYPPEVKFPQGIEILNIFKNYRSKTSILDDCDFYESPQ 243
            QD   G F VKW  +KDVPN QLRHI LENN   P+TN+R   EV   +  ++L I   ++  TSI DD   YE  Q
Sbjct:  494 QDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQ 570          
BLAST of EY756456 vs. ExPASy Swiss-Prot
Match: YTHD3_MOUSE (YTH domain family protein 3 OS=Mus musculus GN=Ythdf3 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.678e-12
Identity = 37/77 (48.05%), Postives = 45/77 (58.44%), Query Frame = 1
Query:   13 QDNCNGYFPVKWHIIKDVPNPQLRHIILENNGATPLTNTRYPPEVKFPQGIEILNIFKNYRSKTSILDDCDFYESPQ 243
            QD   G F VKW  +KDVPN QLRHI LENN   P+TN+R   EV   +  ++L I   ++  TSI DD   YE  Q
Sbjct:  494 QDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQ 570          
BLAST of EY756456 vs. ExPASy Swiss-Prot
Match: YTHD3_HUMAN (YTH domain family protein 3 OS=Homo sapiens GN=YTHDF3 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.678e-12
Identity = 37/77 (48.05%), Postives = 45/77 (58.44%), Query Frame = 1
Query:   13 QDNCNGYFPVKWHIIKDVPNPQLRHIILENNGATPLTNTRYPPEVKFPQGIEILNIFKNYRSKTSILDDCDFYESPQ 243
            QD   G F VKW  +KDVPN QLRHI LENN   P+TN+R   EV   +  ++L I   ++  TSI DD   YE  Q
Sbjct:  494 QDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQ 570          
The following BLAST results are available for this feature:
BLAST of EY756456 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
YTHD1_MOUSE2.588e-1349.35YTH domain family protein 1 OS=Mus musculus GN=Yth... [more]
YTHD2_MACFA5.767e-1348.05YTH domain family protein 2 OS=Macaca fascicularis... [more]
YTHD2_HUMAN5.767e-1348.05YTH domain family protein 2 OS=Homo sapiens GN=YTH... [more]
YTHD2_BOVIN5.767e-1348.05YTH domain family protein 2 OS=Bos taurus GN=YTHDF... [more]
YTHD1_HUMAN9.836e-1348.05YTH domain family protein 1 OS=Homo sapiens GN=YTH... [more]
YTHD3_PONAB1.678e-1248.05YTH domain family protein 3 OS=Pongo abelii GN=YTH... [more]
YTHD3_MOUSE1.678e-1248.05YTH domain family protein 3 OS=Mus musculus GN=Yth... [more]
YTHD3_HUMAN1.678e-1248.05YTH domain family protein 3 OS=Homo sapiens GN=YTH... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-G11-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756456 ID=EY756456|Name=EY756456|organism=Citrus sinensis|type=EST|length=868bp
CCACGCGTCCGACAGGATAATTGCAATGGTTATTTCCCTGTCAAGTGGCA
CATTATAAAAGATGTTCCAAACCCGCAGTTACGACATATAATACTTGAAA
ATAATGGGGCGACCCCTCTAACCAATACCAGATACCCTCCGGAGGTGAAA
TTTCCTCAAGGTATTGAAATTTTGAACATATTTAAAAATTATCGGTCGAA
GACTTCCATATTGGATGATTGTGATTTTTATGAAAGCCCCCAAATTGTGA
TGCTAGAAAAAAAACCCCCACTATCTGTGTGCCGTCTTGATCAAAATCCC
ATACAGTCGAAACCCTATGACTTAACCTCCAGCTTTCAATGGATAGGGGT
ATCTGCTGTATAAAATGTTAATGGCTGCAAGGAATAAGGGAATTAATAAA
GGAGGGCACCGTCTTGTTGGATTGATTAATGAAAGCCAATGGATGCACTG
GGACACTTCTTCCCCATCACTGCTGATGGGATTCCACCTGAAGCTTGATG
CAGAAGACTCCCTTGAGAGATGAAATAATGTTTTTTAACGAAACGCCAAC
CCCTTGAATAGTTTTGGTGGTACTGTTGCACGCAAGAAGCTTCCCTCACA
CAGAAAATGGTATGATCTTTTGGGTGACCTTCCCATAACACAGTGGTCGT
CNGTTTGGCATATAGAAAAACATGATTCCCACATCGCAGTGAGATCTTTA
TGCAAGAGGGTGCTCATCCTATTACTTCCATAGGTGAGAATCGATTGTAT
TCCCACCACTCACATTTACTTTAAGCGAATCATTCCGCCACCACGATGTG
CCTTTTTCGGTAACGTGNGGGAAGCCCTTATGATTACTCCCCAAGAGATT
GAAATTGGTTCTATTGGC
back to top