EY756455

Overview
NameEY756455
Unique NameEY756455
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length911
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756455 vs. ExPASy Swiss-Prot
Match: HMGL_IPONI (HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 4.297e-30
Identity = 73/132 (55.30%), Postives = 88/132 (66.67%), Query Frame = 3
Query:   54 MKGGRSKADAVGTDSKLKSKGARAGKRTXXXXXXXXXXXXXXXXSAFFVFMEEFRKQFKEAHPNNKSVATVGKAAGEKWKSMSEDEKAPFVERAEKRKSDYNKNMQDYNKQLADGVNAAEENESDKSKSEVN 449
            MKGG+SKA +   D+KL  K  +A                    SAFFVFME+FRK +KE HPNNKSVA VGKA G+KWK ++  EKAPF+ +AEKRK +Y KN+Q YNK+ A G  AAEE ESDKS+SEVN
Sbjct:    1 MKGGKSKAKS---DNKLAVK-KQAADTKKTKKAVKDPNKPKRPPSAFFVFMEDFRKTYKEKHPNNKSVAVVGKAGGDKWKQLTAAEKAPFISKAEKRKQEYEKNLQAYNKKQAAG--AAEEEESDKSRSEVN 126          
BLAST of EY756455 vs. ExPASy Swiss-Prot
Match: HMGL_SOYBN (HMG1/2-like protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.132e-29
Identity = 68/136 (50.00%), Postives = 86/136 (63.24%), Query Frame = 3
Query:   54 MKGGRSKADAVGTDSKL----KSKGARAGKRTXXXXXXXXXXXXXXXXSAFFVFMEEFRKQFKEAHPNNKSVATVGKAAGEKWKSMSEDEKAPFVERAEKRKSDYNKNMQDYNKQLADGVNAAEENESDKSKSEVN 449
            MKGG+SK ++   D KL    K    +A K                  SAFFVFMEEFRK F + HP NK+V+ VGKAAG KWK+MS+ EKAP+V ++EKRK +Y KNM+ YNK+ A+G    +E ES+KS SEVN
Sbjct:    1 MKGGKSKTESKRADPKLAVNKKGAATKARKPAGKGKAAKDPNKPKRPPSAFFVFMEEFRKVFNKEHPENKAVSAVGKAAGAKWKTMSDAEKAPYVAKSEKRKVEYEKNMRAYNKKQAEGPTGGDEEESEKSVSEVN 136          
BLAST of EY756455 vs. ExPASy Swiss-Prot
Match: HMGL_VICFA (HMG1/2-like protein OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 8.959e-28
Identity = 69/137 (50.36%), Postives = 89/137 (64.96%), Query Frame = 3
Query:   54 MKGGRSKADAVGTDSKL--KSKGARA---GKRTXXXXXXXXXXXXXXXXSAFFVFMEEFRKQFKEAHPNNKSVATVGKAAGEKWKSMSEDEKAPFVERAEKRKSDYNKNMQDYNKQLADGVNAAEENESDKSKSEVN 449
            MKGG+SK ++   ++KL    KGA A   GK+                 SAFFVFM +FR+Q+K+ HPNNKSVA VGKA GE+WKS+SE+EKAP+V+RA K+K +Y   +Q YNK+L       +E  SDKSKSEVN
Sbjct:    1 MKGGKSKGESKKAETKLAVNKKGAAATKGGKKPAKGKEPKDPNKPKRPPSAFFVFMADFREQYKKDHPNNKSVAAVGKACGEEWKSLSEEEKAPYVDRALKKKEEYEITLQAYNKKLE---GKDDEEGSDKSKSEVN 134          
BLAST of EY756455 vs. ExPASy Swiss-Prot
Match: MNB1B_MAIZE (DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.294e-26
Identity = 71/142 (50.00%), Postives = 86/142 (60.56%), Query Frame = 3
Query:   54 MKGGRSKADAVGTDSKL--KSKGARAGKRTXXXXXXXXXXXXXXXXSAFFVFMEEFRKQFKEAHPNNKSVATVGKAAGEKWKSMSEDEKAPFVERAEKRKSDYNKNMQDYNKQLADGVNAA--------EENESDKSKSEVN 449
            MKG +SK  A   D+KL  KSKGA    +                 SAFFVFMEEFRK+FKE +P NKSVA VGKAAG++WKS+SE +KAP+V +A K K +YNK +  YNK  +     A        +E ESDKSKSEVN
Sbjct:    1 MKGAKSKG-AAKADAKLAVKSKGAEKPAKGRKGKAGKDPNKPKRAPSAFFVFMEEFRKEFKEKNPKNKSVAAVGKAAGDRWKSLSESDKAPYVAKANKLKLEYNKAIAAYNKGESTAAKKAPAKEEEEEDEEESDKSKSEVN 141          
BLAST of EY756455 vs. ExPASy Swiss-Prot
Match: HMGL_WHEAT (HMG1/2-like protein OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 7.099e-25
Identity = 70/146 (47.95%), Postives = 86/146 (58.90%), Query Frame = 3
Query:   54 MKGGRSKADAVGTDSKL--KSKGA-RAGKRTXXXXXXXXXXXXXXXXSAFFVFMEEFRKQFKEAHPNNKSVATVGKAAGEKWKSMSEDEKAPFVERAEKRKSDYNKNMQDYN-----------KQLADGVNAAEENESDKSKSEVN 449
            MKG +SK  A   D+KL  KSKGA +   +                 SAFFVFM EFR++FK+ +P NKSVA VGKAAGE+WKS+SE EKAP+V +A K K +YNK +  YN           K  A  V   +E ESDKSKSE+N
Sbjct:    1 MKGAKSKG-AAKADAKLAVKSKGAEKPAAKGKKGKAGKDPNKPKRAPSAFFVFMGEFREEFKQKNPKNKSVAAVGKAAGERWKSLSESEKAPYVAKANKLKGEYNKAIAAYNKGESAAAAAPKKAAAKEVEEEDEEESDKSKSEIN 145          
BLAST of EY756455 vs. ExPASy Swiss-Prot
Match: HMGB3_BOVIN (High mobility group protein B3 OS=Bos taurus GN=HMGB3 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 4.467e-11
Identity = 46/136 (33.82%), Postives = 67/136 (49.26%), Query Frame = 3
Query:   69 SKADAVGTDSKLKSKG-ARAGKRTXXXXXXXXXXXXXXXXSAFFVFMEEFRKQFKEAHPNNKSVATVGKAAGEKWKSMSEDEKAPFVERAEKRKSDYNKNMQDY-NKQLADGVNAA---------EENESDKSKSE 443
            +KAD V  D ++K  G A+ GK+                 S FF+F  EFR + K A+P   S+  V K  GE W ++S+ EK P++ +A K K  Y K++ DY +K   DG   A         EE+E D+ + E
Sbjct:   64 AKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPP------SGFFLFCSEFRPKIKSANPGI-SIGDVAKKLGEMWNNLSDSEKQPYINKAAKLKEKYEKDVADYKSKGKFDGAKGAAKVARKKVEEEDEEDEEEEE 192          
The following BLAST results are available for this feature:
BLAST of EY756455 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
HMGL_IPONI4.297e-3055.30HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1[more]
HMGL_SOYBN2.132e-2950.00HMG1/2-like protein OS=Glycine max PE=2 SV=1[more]
HMGL_VICFA8.959e-2850.36HMG1/2-like protein OS=Vicia faba PE=2 SV=1[more]
MNB1B_MAIZE1.294e-2650.00DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=... [more]
HMGL_WHEAT7.099e-2547.95HMG1/2-like protein OS=Triticum aestivum PE=2 SV=1[more]
HMGB3_BOVIN4.467e-1133.82High mobility group protein B3 OS=Bos taurus GN=HM... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-G10-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756455 ID=EY756455|Name=EY756455|organism=Citrus sinensis|type=EST|length=911bp
CCACGCGTCCGATCCTTTTGTCTTCCAAAACCCTAACCTCACCAGGATTC
ATCATGAAAGGAGGCAGATCGAAAGCTGACGCCGTAGGAACTGATAGCAA
GCTGAAGAGCAAAGGGGCGAGAGCCGGCAAGCGAACAGCGAAGCCCAAGG
CTGCGAAAGATCCAAACAAGCCGAAGAGGCCTCCTAGTGCTTTCTTCGTT
TTCATGGAGGAGTTCAGGAAGCAGTTCAAAGAAGCTCATCCTAACAATAA
ATCTGTTGCTACTGTTGGCAAAGCTGCTGGAGAAAAATGGAAGTCAATGT
CAGAAGATGAGAAAGCGCCATTCGTTGAAAGGGCTGAGAAAAGAAAGTCT
GATTACAACAAGAACATGCAGGATTACAACAAGCAGTTGGCTGATGGAGT
AAATGCTGCTGAGGAAAATGAATCTGACAAGTCCAAGTCTGAAGTGAATG
ATGAGGATGATGAAGAAGGCAGTGGAGAGGAGGAAGATGATGACTAGAGA
ATGGCAGCGAAGGATTCAAAAATGTTGAAGTTTTAGCAATCTAGTAGAAT
TGCTTATAACATGATAACCCTTAGCCTTTTAGATTAGATTAGGAAAGACA
TCAAGTGTTGTTCAGGATTTACTGAAGCACCATATGGATGGATATGTACC
TAAATGTTCTCTTAAGTCTTTAATCATCTAGCTTCAACNATTATATGGAT
TATTTATTTGGCTATCCTGTTGGCTTATTCAGTTATTTTTCATGGTGGGG
CACATTGGCCACTGGCTGNNTGGTGCTTTTGATGTCAATTGCGATATAGC
AAATTGTGTCAGGCNAGGCAGTGCTACTGAAATATTTGAGATTTGATCTA
TCTAATGGTTTGTTTGCTTAAAAAAAAAAAAAAAAAAAAAAAAAAAGGGC
GGCGGTCTGAG
back to top