EY756451

Overview
NameEY756451
Unique NameEY756451
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length629
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9041 contig Csv1_Contig9041:397..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756451 vs. ExPASy Swiss-Prot
Match: SNRPA_XENLA (U1 small nuclear ribonucleoprotein A OS=Xenopus laevis GN=snrpa PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.426e-16
Identity = 44/91 (48.35%), Postives = 61/91 (67.03%), Query Frame = 2
Query:  161 PGGAKSVIPEAPAPPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQ-QQLLITYAKK 430
            PG    + P +  PPN+ILF+ N+P +T  + L M F+QFPGFKEVR+V  +  IAFVE+ +E+QA  A +SLQ  KI Q   + I++AKK
Sbjct:  192 PGQMAPMQPISENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARESLQGFKITQSNSMKISFAKK 282          
BLAST of EY756451 vs. ExPASy Swiss-Prot
Match: SNRPA_PIG (U1 small nuclear ribonucleoprotein A OS=Sus scrofa GN=SNRPA PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.433e-16
Identity = 48/115 (41.74%), Postives = 66/115 (57.39%), Query Frame = 2
Query:   98 GLNPXXXXXXXXTPPLSQIPY---PGGAKSVIPEAPAPPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLL-ITYAKK 430
            G+ P         PP +  P    PG      P +  PPN+ILF+ N+P +T  + L M F+QFPGFKEVR+V  +  IAFVE+ +E+QA  A  +LQ  KI Q   + I++AKK
Sbjct:  168 GMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK 282          
BLAST of EY756451 vs. ExPASy Swiss-Prot
Match: SNRPA_MOUSE (U1 small nuclear ribonucleoprotein A OS=Mus musculus GN=Snrpa PE=2 SV=3)

HSP 1 Score: 85.5001 bits (210), Expect = 2.433e-16
Identity = 48/115 (41.74%), Postives = 66/115 (57.39%), Query Frame = 2
Query:   98 GLNPXXXXXXXXTPPLSQIPY---PGGAKSVIPEAPAPPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLL-ITYAKK 430
            G+ P         PP +  P    PG      P +  PPN+ILF+ N+P +T  + L M F+QFPGFKEVR+V  +  IAFVE+ +E+QA  A  +LQ  KI Q   + I++AKK
Sbjct:  173 GMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK 287          
BLAST of EY756451 vs. ExPASy Swiss-Prot
Match: SNRPA_HUMAN (U1 small nuclear ribonucleoprotein A OS=Homo sapiens GN=SNRPA PE=1 SV=3)

HSP 1 Score: 85.5001 bits (210), Expect = 2.433e-16
Identity = 48/115 (41.74%), Postives = 66/115 (57.39%), Query Frame = 2
Query:   98 GLNPXXXXXXXXTPPLSQIPY---PGGAKSVIPEAPAPPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLL-ITYAKK 430
            G+ P         PP +  P    PG      P +  PPN+ILF+ N+P +T  + L M F+QFPGFKEVR+V  +  IAFVE+ +E+QA  A  +LQ  KI Q   + I++AKK
Sbjct:  168 GMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK 282          
BLAST of EY756451 vs. ExPASy Swiss-Prot
Match: SNRPA_BOVIN (U1 small nuclear ribonucleoprotein A OS=Bos taurus GN=SNRPA PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.433e-16
Identity = 48/115 (41.74%), Postives = 66/115 (57.39%), Query Frame = 2
Query:   98 GLNPXXXXXXXXTPPLSQIPY---PGGAKSVIPEAPAPPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLL-ITYAKK 430
            G+ P         PP +  P    PG      P +  PPN+ILF+ N+P +T  + L M F+QFPGFKEVR+V  +  IAFVE+ +E+QA  A  +LQ  KI Q   + I++AKK
Sbjct:  168 GMIPPPGLAPGQLPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK 282          
BLAST of EY756451 vs. ExPASy Swiss-Prot
Match: SNRPA_DROME (U1 small nuclear ribonucleoprotein A OS=Drosophila melanogaster GN=snf PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.690e-15
Identity = 44/93 (47.31%), Postives = 59/93 (63.44%), Query Frame = 2
Query:  161 PGGAKSVIPEAPA--PPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLL-ITYAKK 430
            P  A++  P A    PPN ILF+ N+P +T  M L M F+QFPGFKEVR+V  +  IAFVE+  E+Q+  A ++LQ  KI     + IT+AKK
Sbjct:  124 PSSAENSNPNAQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK 216          
BLAST of EY756451 vs. ExPASy Swiss-Prot
Match: RU2B_MOUSE (U2 small nuclear ribonucleoprotein B'' OS=Mus musculus GN=Snrpb2 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.992e-15
Identity = 44/90 (48.89%), Postives = 57/90 (63.33%), Query Frame = 2
Query:  167 GAKSVIPEAPA-PPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLL-ITYAKK 430
            G  +  P+ P  PPN ILF+ N+P +T  M L M F+QFPGFKEVR+V  +  IAFVE+ ++ QA  A  +LQ  KI     + ITYAKK
Sbjct:  136 GTAAPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK 225          
BLAST of EY756451 vs. ExPASy Swiss-Prot
Match: RU2B_HUMAN (U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens GN=SNRPB2 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.826e-15
Identity = 43/84 (51.19%), Postives = 55/84 (65.48%), Query Frame = 2
Query:  185 PEAPA-PPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLL-ITYAKK 430
            P+ P  PPN ILF+ N+P +T  M L M F+QFPGFKEVR+V  +  IAFVE+ ++ QA  A  +LQ  KI     + ITYAKK
Sbjct:  142 PQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK 225          
BLAST of EY756451 vs. ExPASy Swiss-Prot
Match: RU2B_DICDI (U2 small nuclear ribonucleoprotein B'' OS=Dictyostelium discoideum GN=snrpb2 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.625e-14
Identity = 36/72 (50.00%), Postives = 50/72 (69.44%), Query Frame = 2
Query:  200 PPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLLI 415
            PPN  LFV+N+P     M L M FSQF GFKEV MVE+K GIAF+E+ DE+++  AM +LQ  K+  ++ ++
Sbjct:  164 PPNKTLFVENLPDKCDSMMLSMLFSQFQGFKEVHMVESKKGIAFIEFEDEIKSGFAMTNLQHFKVTPEKPMV 235          
BLAST of EY756451 vs. ExPASy Swiss-Prot
Match: RU1A_SCHPO (U1 small nuclear ribonucleoprotein usp102 OS=Schizosaccharomyces pombe GN=usp102 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.476e-13
Identity = 36/86 (41.86%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  173 KSVIPEAPAPPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLLITYAKK 430
            KS I E   PPN +L +QN+P +     L   F  F GF+EVRMV  + GIAFVEY  + +ATVA      + +   Q+ +T+A+K
Sbjct:  162 KSTINEDLLPPNKVLLLQNIPQEVNADVLTQIFEAFSGFQEVRMVPGRRGIAFVEYDSDREATVAKNGTTGMSLSGNQIKVTFARK 247          
The following BLAST results are available for this feature:
BLAST of EY756451 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
SNRPA_XENLA1.426e-1648.35U1 small nuclear ribonucleoprotein A OS=Xenopus la... [more]
SNRPA_PIG2.433e-1641.74U1 small nuclear ribonucleoprotein A OS=Sus scrofa... [more]
SNRPA_MOUSE2.433e-1641.74U1 small nuclear ribonucleoprotein A OS=Mus muscul... [more]
SNRPA_HUMAN2.433e-1641.74U1 small nuclear ribonucleoprotein A OS=Homo sapie... [more]
SNRPA_BOVIN2.433e-1641.74U1 small nuclear ribonucleoprotein A OS=Bos taurus... [more]
SNRPA_DROME2.690e-1547.31U1 small nuclear ribonucleoprotein A OS=Drosophila... [more]
RU2B_MOUSE5.992e-1548.89U2 small nuclear ribonucleoprotein B'' OS=Mus musc... [more]
RU2B_HUMAN7.826e-1551.19U2 small nuclear ribonucleoprotein B'' OS=Homo sap... [more]
RU2B_DICDI6.625e-1450.00U2 small nuclear ribonucleoprotein B'' OS=Dictyost... [more]
RU1A_SCHPO1.476e-1341.86U1 small nuclear ribonucleoprotein usp102 OS=Schiz... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-G05-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756451 ID=EY756451|Name=EY756451|organism=Citrus sinensis|type=EST|length=629bp
CCACGCGTCCGCCTTTGTTCCACGTGAAAGACGAAAACGGCACGAGGAAA
AGGGTAAAAAGCGGAAAGACCAACATGATGCTAATCAAGCAGGAATGGGT
CTGAATCCTGCATATGCTGGTGCCTACGGTGCAACACCTCCTCTATCACA
AATACCCTATCCAGGTGGTGCAAAATCTGTGATCCCCGAGGCTCCAGCTC
CACCTAATAACATCCTATTTGTTCAGAATGTTCCCCATGATACAACTCCA
ATGGCGCTGCAAATGTTCTTCTCCCAGTTCCCTGGTTTTAAGGAGGTTAG
GATGGTGGAGGCAAAACCCGGGATTGCCTTTGTGGAGTATGGAGATGAAA
TGCAAGCAACAGTTGCAATGCAGTCACTCCAAAGTTTAAAGATTGGCCAG
CAACAGTTGTTGATCACTTATGCCAAGAAATAGATGCAATCTCTGTTGAT
TACCTTTCGCAATTTTTTATTATCATTGCAGGCAAATATTTAACTTCATA
CATTGTCAATCTAGTTAGATGTCATGTTTGCTAATTTGTGGTTTCCTGTT
ACATGCTATGTTTCACAGGAGCCTCTGTGCTTATATGTATGAAAATGGCT
GCACAAGTTCTTGCAAAAAAAAAAAAAAA
back to top