EY756264

Overview
NameEY756264
Unique NameEY756264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_CITSI (Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 4.085e-55
Identity = 97/120 (80.83%), Postives = 102/120 (85.00%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            PG I  NI+K L+E+  PLGISDWNSIFWIAHPGGPAILDQVES          ATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVL  FGPGLTV+TVVLHSVPI+A
Sbjct:  272 PGLISKNIEKSLSEAFAPLGISDWNSIFWIAHPGGPAILDQVESKLGLKGEKLKATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 391          

HSP 2 Score: 41.9726 bits (97), Expect = 4.085e-55
Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     +   LDSL GQ LF  GAA VI  A  D   ER + Q
Sbjct:  181 NKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQ 238          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_PETCR (Chalcone synthase OS=Petroselinum crispum GN=CHS PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 3.356e-51
Identity = 89/117 (76.07%), Postives = 96/117 (82.05%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            PG I  NI+K L E+  P+GISDWNS+FWIAHPGGPAILDQVE           ATRQVLS+YGNMSSACVLFILDEMRKKS+EE KATTGEGLDWGVL  FGPGLTV+TVVLHSVP
Sbjct:  277 PGLISKNIEKSLKEAFGPIGISDWNSLFWIAHPGGPAILDQVELKLGLKEEKMRATRQVLSDYGNMSSACVLFILDEMRKKSIEEGKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 393          

HSP 2 Score: 40.817 bits (94), Expect = 3.356e-51
Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  GAA VI  +  D   ER + Q
Sbjct:  186 NAGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVILGSDPDLSVERPLFQ 243          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_DAUCA (Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 5.701e-51
Identity = 88/117 (75.21%), Postives = 96/117 (82.05%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            PG I  NI+K L E+  P+GISDWNS+FWIAHPGGPAILDQVE           ATRQVLS+YGNMSSACVLFILDEMRKKS+EE KATTG+GLDWGVL  FGPGLTV+TVVLHSVP
Sbjct:  276 PGLISKNIEKSLKEAFGPIGISDWNSLFWIAHPGGPAILDQVELKLGLKEEKMRATRQVLSDYGNMSSACVLFILDEMRKKSIEEGKATTGDGLDWGVLFGFGPGLTVETVVLHSVP 392          

HSP 2 Score: 41.2022 bits (95), Expect = 5.701e-51
Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  GAA VI  +  D   ER + Q
Sbjct:  185 NTGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDPDLSVERPLFQ 242          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS1_RUTGR (Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.263e-50
Identity = 89/120 (74.17%), Postives = 96/120 (80.00%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            PG I  NI+K L E+  P+GISDWNSIFWIAHPGGPAILDQVE+          ATRQVLSEYGNMSSACVLFILDEMRK   EE +ATTGEGLDWGVL  FGPGLTV+TVVL SVPI+A
Sbjct:  274 PGLISKNIEKSLKEAFGPIGISDWNSIFWIAHPGGPAILDQVEAKLGLKEEKLRATRQVLSEYGNMSSACVLFILDEMRKNCAEEGRATTGEGLDWGVLFGFGPGLTVETVVLRSVPIKA 393          

HSP 2 Score: 41.2022 bits (95), Expect = 1.263e-50
Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     +   LDSL GQ LF  GAA VI  A  D   ER + Q
Sbjct:  183 NRGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDESIERPLYQ 240          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_RUTGR (Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 2.145e-50
Identity = 90/120 (75.00%), Postives = 96/120 (80.00%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            PG I  NI+K L E+  P+GISDWNSIFWIAHPGGPAILDQVE+          ATRQVLSEYGNMSSACVLFILDEMRKK  EE +ATTGEGLDWGVL  FGPGLTV+TVVL SVPI A
Sbjct:  274 PGLISKNIEKSLKEAFGPIGISDWNSIFWIAHPGGPAILDQVEAKLGLKEEKLRATRQVLSEYGNMSSACVLFILDEMRKKCAEEGRATTGEGLDWGVLFGFGPGLTVETVVLRSVPINA 393          

HSP 2 Score: 39.2762 bits (90), Expect = 2.145e-50
Identity = 26/58 (44.83%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     +   LDSL GQ LF  GAA VI  A  +   ER + Q
Sbjct:  183 NRGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPNESIERPLYQ 240          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_ORYSJ (Chalcone synthase OS=Oryza sativa subsp. japonica GN=CHS PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.796e-50
Identity = 86/120 (71.67%), Postives = 96/120 (80.00%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            PG I  NI++ L ++  PLGISDWNSIFW+AHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMRK+S E+  ATTGEG+DWGVL  FGPGLTV+TVVLHSVPI A
Sbjct:  275 PGLISKNIERALGDAFTPLGISDWNSIFWVAHPGGPAILDQVEAKVGLDKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGHATTGEGMDWGVLFGFGPGLTVETVVLHSVPITA 394          

HSP 2 Score: 41.2022 bits (95), Expect = 2.796e-50
Identity = 26/58 (44.83%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDS+ GQ LF  GAA VI  +  D   ER + Q
Sbjct:  184 NRGARVLAVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGSDPDEAVERPLFQ 241          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_ORYSI (Chalcone synthase OS=Oryza sativa subsp. indica GN=CHS PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.796e-50
Identity = 86/120 (71.67%), Postives = 96/120 (80.00%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPIRA 651
            PG I  NI++ L ++  PLGISDWNSIFW+AHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMRK+S E+  ATTGEG+DWGVL  FGPGLTV+TVVLHSVPI A
Sbjct:  275 PGLISKNIERALGDAFTPLGISDWNSIFWVAHPGGPAILDQVEAKVGLDKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGHATTGEGMDWGVLFGFGPGLTVETVVLHSVPITA 394          

HSP 2 Score: 41.2022 bits (95), Expect = 2.796e-50
Identity = 26/58 (44.83%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDS+ GQ LF  GAA VI  +  D   ER + Q
Sbjct:  184 NRGARVLAVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGSDPDEAVERPLFQ 241          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_BETVE (Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 6.193e-50
Identity = 87/118 (73.73%), Postives = 95/118 (80.51%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI+K LAE+  PLGISDWNS+FWIAHPGGPAILDQVES          ATR VLSEYGNMSSACVLFILDEMR+ S+E  K TTGEGL+WGVL  FGPGLTV+TVVLHSVP+
Sbjct:  272 PGIISKNIEKSLAEAFAPLGISDWNSLFWIAHPGGPAILDQVESKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRRNSLEGGKVTTGEGLEWGVLFGFGPGLTVETVVLHSVPV 389          

HSP 2 Score: 40.817 bits (94), Expect = 6.193e-50
Identity = 26/56 (46.43%), Postives = 30/56 (53.57%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTM 179
            N GARV+ VCSE   +     +   LDSL GQ LF  GAA VI  A  D   ER +
Sbjct:  181 NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGADPDTSVERPL 236          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHS2_MAIZE (Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 8.071e-50
Identity = 86/118 (72.88%), Postives = 95/118 (80.51%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVPI 645
            PG I  NI + L ++  PLGISDWNSIFW+AHPGGPAILDQVE+          ATR VLSEYGNMSSACVLFILDEMRK+S E+ +ATTGEGLDWGVL  FGPGLTV+TVVLHSVPI
Sbjct:  276 PGLISKNIGRALDDAFKPLGISDWNSIFWVAHPGGPAILDQVEAKVGLDKARMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 393          

HSP 2 Score: 41.2022 bits (95), Expect = 8.071e-50
Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTMCQ 185
            N GARV+ VCSE   +     S   LDSL GQ LF  GAA V+  A  D   ER + Q
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVVVGADPDDRVERPLFQ 242          
BLAST of EY756264 vs. ExPASy Swiss-Prot
Match: CHSY_CALCH (Chalcone synthase OS=Callistephus chinensis GN=CHS PE=2 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 1.052e-49
Identity = 85/117 (72.65%), Postives = 93/117 (79.49%), Query Frame = 1
Query:  292 PGWICPNIKKCLAESVPPLGISDWNSIFWIAHPGGPAILDQVESXXXXXXXXXXATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLLRFGPGLTVQTVVLHSVP 642
            PG I  NI+K L ++  PLGI+DWNSIFWIAHPGGPAILDQVE           ATR VLSEYGNMSSACVLFI+DEMRKKS E+  ATTGEGLDWGVL  FGPGLTV+TVVLHS+P
Sbjct:  275 PGLISKNIEKALTQAFSPLGITDWNSIFWIAHPGGPAILDQVELKLGLKEEKMRATRHVLSEYGNMSSACVLFIIDEMRKKSAEDGAATTGEGLDWGVLFGFGPGLTVETVVLHSLP 391          

HSP 2 Score: 42.743 bits (99), Expect = 1.052e-49
Identity = 27/56 (48.21%), Postives = 31/56 (55.36%), Query Frame = 3
Query:   12 NMGARVIDVCSESHGILSSPCS*LILDSLAGQTLFW*GAAGVIGVAHTDAITERTM 179
            N GARV+ VCSE   +     +   LDSL GQ LF  GAA VI  A  D  TER +
Sbjct:  184 NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGADPDLTTERPL 239          
The following BLAST results are available for this feature:
BLAST of EY756264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 144
Match NameE-valueIdentityDescription
CHS2_CITSI4.085e-5580.83Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=... [more]
CHSY_PETCR3.356e-5176.07Chalcone synthase OS=Petroselinum crispum GN=CHS P... [more]
CHS2_DAUCA5.701e-5175.21Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 ... [more]
CHS1_RUTGR1.263e-5074.17Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=... [more]
CHS2_RUTGR2.145e-5075.00Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=... [more]
CHSY_ORYSJ2.796e-5071.67Chalcone synthase OS=Oryza sativa subsp. japonica ... [more]
CHSY_ORYSI2.796e-5071.67Chalcone synthase OS=Oryza sativa subsp. indica GN... [more]
CHSY_BETVE6.193e-5073.73Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 ... [more]
CHS2_MAIZE8.071e-5072.88Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1[more]
CHSY_CALCH1.052e-4972.65Chalcone synthase OS=Callistephus chinensis GN=CHS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756264 ID=EY756264|Name=EY756264|organism=Citrus sinensis|type=EST|length=922bp
CCACGCGTCCGAACATGGGCGCTCGAGTTATTGATGTCTGCTCTGAATCA
CATGGAATTCTTTCCTCGCCCTGCTCTTGACTCATCTTGGATTCTCTTGC
GGGCCAGACTCTGTTCTGGTAGGGGGCTGCGGGTGTGATCGGTGTAGCCC
ATACTGACGCCATTACTGAGCGTACGATGTGTCAACTTGCGTGACTACAT
GCGCACACTATGCTCCATTGATCTGACCATGTCTTTGACTGTACTCTTGC
ACTCACATGCAGCTGCACTTGCCCTTTGCTATAGATACCATCCCGGATGG
ATCTGTCCTAATATAAAAAAATGCCTGGCTGAATCGGTCCCCCCGCTTGG
CATCAGCGACTGGAACTCGATATTCTGGATCGCTCACCCCGGTGGGCCCG
CAATTCTGGACCAAGTGGAGTCTAAACTGGGCCTCAAAGGGGAGAAGCTG
AAGGCCACGCGTCAAGTGTTGAGTGAGTACGGTAACATGTCAAGCGCTTG
TGTCTTGTTCATCCTTGACGAGATGAGAAAGAAGTCTGTTGAGGAAGCGA
AAGCCACCACCGGCGAAGGGCTTGATTGGGGTGTGCTGCTCAGGTTCGGG
CCGGGGCTCACCGTCCAGACCGTTGTGCTGCACAGTGTCCCCATCAGAGC
TTGCAGTGAGAACTCCATCANTATGTTTAGTAGTTCAGGAACTTTATGTT
GTATGCTTTCACAGTTGAGTTATTGGGTGATCGTGTGAAGGTTTANTTTT
GTCAATTGAGTTTAGGCATCGGGCCTTTTCTCTATGACGTCACTAAACTG
GGCAACGCTTTGGGTTATGCATAATTCTTGGGAATTGAAAAGGAGGGAAT
TCCTAAAAGATACAAAAAAGAAAAAAGGCCGCCCGTCTNAAGATCTAGCT
TAGGTAGGGTGCTGGAGGTCCT
back to top