EY756262

Overview
NameEY756262
Unique NameEY756262
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1046
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756262 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 3.695e-84
Identity = 156/202 (77.23%), Postives = 174/202 (86.14%), Query Frame = 2
Query:  143 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGKPNLIHAQNILAIWALQVALMGAVGGLQNCWRGRSGKMIDPFEPRWPALNPLG 739
            MATSTMALSSS F GKAV L+PS +E++  GR++MRKT +K+   SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLG P+L+HAQ+ILAIWA QV LMGAV G +    G  G+++DP  P   + +PLG
Sbjct:    1 MATSTMALSSSTFAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIA-GGPLGEVVDPLYP-GGSFDPLG 200          
BLAST of EY756262 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 4.825e-84
Identity = 156/202 (77.23%), Postives = 174/202 (86.14%), Query Frame = 2
Query:  143 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGKPNLIHAQNILAIWALQVALMGAVGGLQNCWRGRSGKMIDPFEPRWPALNPLG 739
            MA STMALSS SF GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLG P+L+HAQ+ILAIWA QV LMGAV G +    G  G+++DP  P   + +PLG
Sbjct:    1 MAASTMALSSPSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVA-GGPLGEVVDPLYP-GGSFDPLG 200          
BLAST of EY756262 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 4.825e-84
Identity = 154/201 (76.62%), Postives = 172/201 (85.57%), Query Frame = 2
Query:  143 MATSTMALSSSFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGKPNLIHAQNILAIWALQVALMGAVGGLQNCWRGRSGKMIDPFEPRWPALNPLG 739
            MA ST ALSS F GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLG P+L+HAQ+ILAIWA QV LMGAV G +    G  G+++DP  P   + +PLG
Sbjct:    1 MAASTTALSSPFAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVA-GGPLGEVVDPLYP-GGSFDPLG 199          
BLAST of EY756262 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 5.335e-83
Identity = 152/201 (75.62%), Postives = 171/201 (85.07%), Query Frame = 2
Query:  143 MATSTMALSSSFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGKPNLIHAQNILAIWALQVALMGAVGGLQNCWRGRSGKMIDPFEPRWPALNPLG 739
            MA ST ALSS F GKAV L+PS +E++  G+++MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLG P+L+HAQ+ILAIWA QV LMGAV G +       G+++DP  P   + +PLG
Sbjct:    1 MAASTTALSSPFAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGE-PLGEVVDPLYP-GGSFDPLG 199          
BLAST of EY756262 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 5.335e-83
Identity = 153/200 (76.50%), Postives = 171/200 (85.50%), Query Frame = 2
Query:  143 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGKPNLIHAQNILAIWALQVALMGAVGGLQNCWRGRSGKMIDPFEPRWPALNPLG 739
            MA +TMALSS SF G+AV L+PS  E++  GR+SMRKT +K V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLG P+L+HAQ+ILAIWA QV LMGAV G +    G  G+++DP  P   + +PLG
Sbjct:    1 MAAATMALSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVA-GGPLGEVVDPLYP-GGSFDPLG 198          
BLAST of EY756262 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 6.968e-83
Identity = 153/200 (76.50%), Postives = 170/200 (85.00%), Query Frame = 2
Query:  143 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGKPNLIHAQNILAIWALQVALMGAVGGLQNCWRGRSGKMIDPFEPRWPALNPLG 739
            MA +TMALSS SF G+AV L+PS +E+S  GRI+MRK  +KS  S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLG P+L+HAQ+ILAIWA QV LMGAV G +    G  G+++DP  P   + +PLG
Sbjct:    1 MAAATMALSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIA-GGPLGEVVDPLYP-GGSFDPLG 198          
BLAST of EY756262 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 1.189e-82
Identity = 153/202 (75.74%), Postives = 174/202 (86.14%), Query Frame = 2
Query:  143 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGKPNLIHAQNILAIWALQVALMGAVGGLQNCWRGRSGKMIDPFEPRWPALNPLG 739
            MA +TMALSSS F GKAV L+PS +E++  G+++MRKT +K+  +SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLG P+L+HAQ+ILAIWA QV LMGAV G +    G  G+++DP  P   + +PLG
Sbjct:    1 MAAATMALSSSSFAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVA-GGPLGEVVDPLYP-GGSFDPLG 200          
BLAST of EY756262 vs. ExPASy Swiss-Prot
Match: CB23_NICPL (Chlorophyll a-b binding protein C, chloroplastic OS=Nicotiana plumbaginifolia GN=CABC PE=3 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.927e-81
Identity = 151/202 (74.75%), Postives = 171/202 (84.65%), Query Frame = 2
Query:  143 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGKPNLIHAQNILAIWALQVALMGAVGGLQNCWRGRSGKMIDPFEPRWPALNPLG 739
            MA STMALSSS F GKAV L+PS +E++  G+++MRKT SK+  VSS SPWYGP+RVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK G+QIFS+GGLDYLG P+L+HAQ+ILAIWA QV LMGAV G +       G+++DP  P   + +PLG
Sbjct:    1 MAASTMALSSSSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKGGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGE-PLGEVVDPLYP-GGSFDPLG 200          
BLAST of EY756262 vs. ExPASy Swiss-Prot
Match: CB2A_SPIOL (Chlorophyll a-b binding protein, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 3.823e-81
Identity = 153/202 (75.74%), Postives = 169/202 (83.66%), Query Frame = 2
Query:  143 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSK--SVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGKPNLIHAQNILAIWALQVALMGAVGGLQNCWRGRSGKMIDPFEPRWPALNPLG 739
            MA+STMALSS S  GKAV L P+ +E+   GRI+MRKT  K  +V S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLG P+L+HAQ+ILAIWA QV LMGAV G +    G  G+++DP  P   + +PLG
Sbjct:    1 MASSTMALSSPSLAGKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIA-GGPLGEVVDPLYP-GGSFDPLG 200          
BLAST of EY756262 vs. ExPASy Swiss-Prot
Match: CB25_PETSP (Chlorophyll a-b binding protein 91R, chloroplastic OS=Petunia sp. GN=CAB91R PE=3 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 3.823e-81
Identity = 152/202 (75.25%), Postives = 171/202 (84.65%), Query Frame = 2
Query:  143 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGKPNLIHAQNILAIWALQVALMGAVGGLQNCWRGRSGKMIDPFEPRWPALNPLG 739
            MA +TMALSS SF GKAV  +PS +E++  G+ +MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTA LSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLG P+L+HAQ+ILAIWA QV LMGAV G +    G  G+++DP  P   + +PLG
Sbjct:    1 MAAATMALSSPSFAGKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVA-GGPLGEVVDPLYP-GGSFDPLG 200          
The following BLAST results are available for this feature:
BLAST of EY756262 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 65
Match NameE-valueIdentityDescription
CB2G_SOLLC3.695e-8477.23Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB24_TOBAC4.825e-8477.23Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB21_TOBAC4.825e-8476.62Chlorophyll a-b binding protein 16, chloroplastic ... [more]
CB25_NICPL5.335e-8375.62Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB22_TOBAC5.335e-8376.50Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB2B_SOLLC6.968e-8376.50Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB25_TOBAC1.189e-8275.74Chlorophyll a-b binding protein 50, chloroplastic ... [more]
CB23_NICPL2.927e-8174.75Chlorophyll a-b binding protein C, chloroplastic O... [more]
CB2A_SPIOL3.823e-8175.74Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB25_PETSP3.823e-8175.25Chlorophyll a-b binding protein 91R, chloroplastic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E01-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756262 ID=EY756262|Name=EY756262|organism=Citrus sinensis|type=EST|length=1046bp
AAAAAAAAAAAAAAAAAAAAAAAGCAGTNNNCGNNNNTTCATATAAAAAA
TANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCCCGACCCACGCGT
CCGCGAACACTAGAGCTCACCAACAACTCCGATCATTGTAAAATGGCAAC
CTCGACCATGGCTCTCTCCTCATCATTCGTCGGCAAGGCTGTGAACCTTG
CCCCTTCAGGCAATGAGCTGAGCAATGGTGGCCGCATCTCCATGCGTAAA
ACCGGGAGCAAGTCTGTTTCTTCAGGTAGCCCGTGGTACGGCCCGGACAG
AGTCAAGTACTTGGGTCCATTCTCTGGCGAGCCCCCAAGCTACTTGACTG
GTGAGTTCCCTGGTGACTACGGTTGGGACACTGCTGGGCTTTCAGCTGAC
CCAGAAACCTTTGCCAAGAACCGTGAACTCGAAGTCATCCACTGCAGATG
GGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAGCTCTTGGCCCGCA
ACGGAGTCAAGTTCGGTGAGGCCGTGTGGTTCAAGGCGGGGGCCCAAATC
TTCAGCGAGGGCGGGCTTGACTACTTGGGGAAACCAAACCTGATCCACGC
TCAAAACATCTTGGCCATCTGGGCTTTGCAAGTGGCCTTGATGGGAGCCG
TTGGAGGGTTACAAAATTGCTGGAGGGGCCGCTCGGGGAAAATGATTGAC
CCATTTGAACCCAGGTGGCCAGCTTTAAATCCATTGGGGTTTGGCTGATG
AACCCGGAAGTCTTTTGCTTAACCTCAAGGGTTAAGGAAATCAATAATAT
GGAAGGTTGGCTATGTTCCTCCAACGTTTGGTTTCCTCTGTTAAAGACCA
TTGCCCCCCGGAAAGGGAACCGTTTAAAAAATTTGGGCCCAACCCTTGGC
TTGACCCCGGCAAAAACAATGCGCTGGGCCAACCCCACAAACTTTGTTCC
CCGAAAATAGAACTCCCGGTTAGAAAAAATTCTTCCTCCTTCCGGATCTC
TGGGAATAAGGGAAATACGGTGTGGAGACCACGGAAGAATTTTATT
back to top