EY756261

Overview
NameEY756261
Unique NameEY756261
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length799
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig726 contig Csv1_Contig726:279..1077. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756261 vs. ExPASy Swiss-Prot
Match: DPM1_DROME (Probable dolichol-phosphate mannosyltransferase OS=Drosophila melanogaster GN=CG10166 PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.015e-54
Identity = 103/154 (66.88%), Postives = 124/154 (80.52%), Query Frame = 3
Query:   24 ENASGSFVVIMDADLSHHPKYLPSFIKKQLETGASIVTGTRYVKSGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSVLEDVISSCVSKGYVFQMEMIVRACKKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLITT 485
            ++A+G F+VI+DADLSHHPK++P FIK Q E    IV+GTRY  +GGV GW+  RKL SRGAN L+Q LL P  SDLTGSFRLYKK VLE  I+SCVSKGYVFQMEM+VRA + GY I EVPITFVDR++G+SKLGG+EI+++ K LLYL  TT
Sbjct:   88 KHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVSGTRYAGNGGVFGWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASCVSKGYVFQMEMLVRARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYLFATT 241          
BLAST of EY756261 vs. ExPASy Swiss-Prot
Match: DPM1_HUMAN (Dolichol-phosphate mannosyltransferase OS=Homo sapiens GN=DPM1 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 4.489e-54
Identity = 103/154 (66.88%), Postives = 125/154 (81.17%), Query Frame = 3
Query:   24 ENASGSFVVIMDADLSHHPKYLPSFIKKQLETGASIVTGTRYVKSGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSVLEDVISSCVSKGYVFQMEMIVRACKKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLITT 485
            ++A+G++++IMDADLSHHPK++P FI+KQ E    IV+GTRY  +GGV+GW+L RK+ SRGAN L Q LL PG SDLTGSFRLY+K VLE +I  CVSKGYVFQMEMIVRA +  Y I EVPI+FVDRV+G SKLGG+EIV +LKGLL L  TT
Sbjct:  107 KHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT 260          
BLAST of EY756261 vs. ExPASy Swiss-Prot
Match: DPM1_MOUSE (Dolichol-phosphate mannosyltransferase OS=Mus musculus GN=Dpm1 PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.000e-53
Identity = 102/154 (66.23%), Postives = 125/154 (81.17%), Query Frame = 3
Query:   24 ENASGSFVVIMDADLSHHPKYLPSFIKKQLETGASIVTGTRYVKSGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSVLEDVISSCVSKGYVFQMEMIVRACKKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLITT 485
            ++A+G++V+IMDADLSHHPK++P FI+KQ E    IV+GTRY  +GGV+GW+L RK+ SRGAN + Q LL PG SDLTGSFRLY+K VL+ +I  CVSKGYVFQMEMIVRA +  Y I EVPI+FVDRV+G SKLGG+EIV +LKGLL L  TT
Sbjct:  107 KHATGNYVIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFITQILLRPGASDLTGSFRLYRKEVLQKLIEKCVSKGYVFQMEMIVRARQMNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT 260          
BLAST of EY756261 vs. ExPASy Swiss-Prot
Match: DPM1_CRIGR (Dolichol-phosphate mannosyltransferase OS=Cricetulus griseus GN=DPM1 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.306e-53
Identity = 102/154 (66.23%), Postives = 125/154 (81.17%), Query Frame = 3
Query:   24 ENASGSFVVIMDADLSHHPKYLPSFIKKQLETGASIVTGTRYVKSGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSVLEDVISSCVSKGYVFQMEMIVRACKKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLITT 485
            ++A+G++V+IMDADLSHHPK++P FI+KQ E    IV+GTRY  +GGV+GW+L RK+ SRGAN + Q LL PG SDLTGSFRLY+K VL+ +I  CVSKGYVFQMEMIVRA +  Y I EVPI+FVDRV+G SKLGG+EIV +LKGLL L  TT
Sbjct:  113 KHATGNYVIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFITQILLRPGASDLTGSFRLYRKEVLQKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT 266          
BLAST of EY756261 vs. ExPASy Swiss-Prot
Match: DPM1_PIG (Dolichol-phosphate mannosyltransferase OS=Sus scrofa GN=DPM1 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.706e-53
Identity = 101/154 (65.58%), Postives = 125/154 (81.17%), Query Frame = 3
Query:   24 ENASGSFVVIMDADLSHHPKYLPSFIKKQLETGASIVTGTRYVKSGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSVLEDVISSCVSKGYVFQMEMIVRACKKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLITT 485
            ++A+G++++IMDADLSHHPK++P FI+KQ E    IV+GTRY  +GGV+GW+L RK+ SRGAN + Q LL PG SDLTGSFRLY+K VL+ +I  CVSKGYVFQMEMIVRA +  Y I EVPI+FVDRV+G SKLGG+EIV +LKGLL L  TT
Sbjct:  106 KHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFITQILLRPGASDLTGSFRLYRKEVLQKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT 259          
BLAST of EY756261 vs. ExPASy Swiss-Prot
Match: DPM1_BOVIN (Dolichol-phosphate mannosyltransferase OS=Bos taurus GN=DPM1 PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.463e-52
Identity = 99/154 (64.29%), Postives = 124/154 (80.52%), Query Frame = 3
Query:   24 ENASGSFVVIMDADLSHHPKYLPSFIKKQLETGASIVTGTRYVKSGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSVLEDVISSCVSKGYVFQMEMIVRACKKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLITT 485
            ++A+G++++IMDADLSHHPK++P FI+KQ E    IV+GTRY  +GGV+GW+L RK+ SR AN + Q LL PG SDLTGSFRLY+K VL+ +I  C+SKGYVFQMEMIVRA +  Y I EVPI+FVDRV+G SKLGG+EIV +LKGLL L  TT
Sbjct:  107 KHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRVANFITQILLRPGASDLTGSFRLYRKEVLQKLIGKCISKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT 260          
BLAST of EY756261 vs. ExPASy Swiss-Prot
Match: DPM1_SCHPO (Dolichol-phosphate mannosyltransferase OS=Schizosaccharomyces pombe GN=dpm1 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 3.329e-49
Identity = 98/149 (65.77%), Postives = 113/149 (75.84%), Query Frame = 3
Query:   30 ASGSFVVIMDADLSHHPKYLPSFIKKQLETGASIVTGTRYVKSGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSVLEDVISSCVSKGYVFQMEMIVRACKKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLL 476
            A+G FV+IMDAD SHHPKYLP FIK Q E    IV GTRY K GGV+GWNL RK  SRGAN+LA T+L  GVSD+TGSFRLYKK VLE ++S   SKGYVFQME+I RA +  Y I EVPI FVDR++G SKLG  +I+ YLKG+  LL
Sbjct:   86 ATGDFVIIMDADFSHHPKYLPEFIKLQKEHNYDIVLGTRYAKDGGVYGWNLKRKFISRGANLLASTVLGTGVSDVTGSFRLYKKPVLETLMSEVTSKGYVFQMEIIARAREHNYTIGEVPIAFVDRLYGESKLGMDDILGYLKGVFSLL 234          
BLAST of EY756261 vs. ExPASy Swiss-Prot
Match: DPM1_DICDI (Dolichol-phosphate mannosyltransferase OS=Dictyostelium discoideum GN=dpm1 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.681e-48
Identity = 94/152 (61.84%), Postives = 117/152 (76.97%), Query Frame = 3
Query:   24 ENASGSFVVIMDADLSHHPKYLPSFIKKQLETGASIVTGTRYVKSGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSVLEDVISSCVSKGYVFQMEMIVRACKKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLI 479
            + ++G++V++MDADLSHHPK++P FI+KQ +    IVTGTRY   GGV GWNL RKLTSR AN +A  LL PGVSDLTGSFRLY+K VLE +I+   SKGYVFQ+EM+VRA + GY + EVPITFVDR+FG S L   EIV +LK +L L +
Sbjct:  100 KKSTGNWVILMDADLSHHPKFIPQFIEKQKKLNCEIVTGTRYQSGGGVFGWNLYRKLTSRVANYIASVLLTPGVSDLTGSFRLYRKDVLEKLITQNKSKGYVFQVEMMVRANQLGYQVGEVPITFVDRIFGVSNLDSGEIVGFLKSVLNLFM 251          
The following BLAST results are available for this feature:
BLAST of EY756261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
DPM1_DROME2.015e-5466.88Probable dolichol-phosphate mannosyltransferase OS... [more]
DPM1_HUMAN4.489e-5466.88Dolichol-phosphate mannosyltransferase OS=Homo sap... [more]
DPM1_MOUSE1.000e-5366.23Dolichol-phosphate mannosyltransferase OS=Mus musc... [more]
DPM1_CRIGR1.306e-5366.23Dolichol-phosphate mannosyltransferase OS=Cricetul... [more]
DPM1_PIG1.706e-5365.58Dolichol-phosphate mannosyltransferase OS=Sus scro... [more]
DPM1_BOVIN2.463e-5264.29Dolichol-phosphate mannosyltransferase OS=Bos taur... [more]
DPM1_SCHPO3.329e-4965.77Dolichol-phosphate mannosyltransferase OS=Schizosa... [more]
DPM1_DICDI3.681e-4861.84Dolichol-phosphate mannosyltransferase OS=Dictyost... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D12-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756261 ID=EY756261|Name=EY756261|organism=Citrus sinensis|type=EST|length=799bp
AGGAACTGCTTACTTCATGGTTTGAAAATGCATCGGGCAGTTTTGTTGTG
ATTATGGATGCTGATTTATCCCACCATCCAAAGTACTTGCCGAGCTTCAT
AAAGAAACAGTTGGAGACAGGTGCAAGTATTGTAACTGGAACCCGGTACG
TTAAAAGTGGTGGTGTGCATGGGTGGAATCTTATGCGCAAACTGACTAGT
AGAGGAGCCAATGTCCTTGCTCAAACACTTTTATGGCCTGGTGTATCAGA
TCTCACTGGTTCTTTCCGGCTTTATAAGAAATCAGTGCTTGAAGATGTCA
TTAGTTCCTGTGTGAGTAAGGGATATGTCTTTCAAATGGAGATGATTGTT
CGTGCTTGTAAAAAGGGGTACCACATTGAAGAGGTTCCAATTACATTTGT
TGACAGAGTATTTGGAAGTTCAAAGCTTGGAGGATCTGAAATTGTCGAAT
ATCTTAAAGGCCTTCTATATCTTCTCATCACAACATAAGATGCTATAACT
TCACTCTTCAAGGATTAAGCTGTTGATCACAAGTCACGGGATGGTTCTCT
TATGATCATTTCTTCCTCCACTGATGTTGAAAAAATATCACATTATTTCA
AGTCTCTGATCTGCCCTTTTTTTTATTTTACCTGATGCTCTTGAGTCCTA
GAATTCAGGTAGCAAATTATCTGGTAGTCTTACGAATGATTACTAACTTA
ATGATGGCTGATGAGAGTCAATATGGTTTTTTCATATGAGAGATTGAAAG
TCTTTTTCGAGTCTGATTTGCATCAAAAAAAAAAAGAAAAAAAAAAACA
back to top