EY756260

Overview
NameEY756260
Unique NameEY756260
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length724
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig765 contig Csv1_Contig765:866..1589. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756260 vs. ExPASy Swiss-Prot
Match: OST48_XENTR (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Xenopus tropicalis GN=ddost PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 4.230e-45
Identity = 84/167 (50.30%), Postives = 115/167 (68.86%), Query Frame = 1
Query:   10 RSGNDQFLTEISKWVFHERGHLKDVNVRHHKVGESDEPAIYRINDDLEYSVEIYEWSGTSWEPYVSDDVQVQFYMMSPYVLKTLSTDQKGHYSAEFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 510
            ++GN +    +S+WVF E G L+   V HH+VGES  P+ Y + D +EYS+ I + S   W P+  DD+Q++F  + P+V +T      G YS +FK+PDVYGVFQFKV+Y RLGYT L  + Q+ VRP +H +YERF+P+AYPYY SAFS+M G FIF+IV L+ K
Sbjct:  266 KTGNYELAVALSRWVFKEEGVLRVGQVSHHRVGESSPPSAYTVTDLVEYSIVIEQLSNGKWVPFDGDDIQLEFVRIDPFV-RTFLKKNGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSTTQVSVRPLQHTQYERFIPSAYPYYASAFSVMFGLFIFSIVFLHMK 431          
BLAST of EY756260 vs. ExPASy Swiss-Prot
Match: OST48_MOUSE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Mus musculus GN=Ddost PE=1 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 4.230e-45
Identity = 86/167 (51.50%), Postives = 115/167 (68.86%), Query Frame = 1
Query:   10 RSGNDQFLTEISKWVFHERGHLKDVNVRHHKVGESDEPAIYRINDDLEYSVEIYEWSGTSWEPYVSDDVQVQFYMMSPYVLKTLSTDQKGHYSAEFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 510
            ++GN +    +S+WVF E G L+   V HH+VGE   P  Y + D +EYS+ I + S   W P+  DD+Q++F  + P+V +T    + G YS +FK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMMAG FIF+IV L+ K
Sbjct:  270 QTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGEMAPPNAYTVTDLVEYSIVIEQLSNGKWVPFDGDDIQLEFVRIDPFV-RTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMK 435          
BLAST of EY756260 vs. ExPASy Swiss-Prot
Match: OST48_RAT (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Rattus norvegicus GN=Ddost PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.524e-45
Identity = 84/167 (50.30%), Postives = 116/167 (69.46%), Query Frame = 1
Query:   10 RSGNDQFLTEISKWVFHERGHLKDVNVRHHKVGESDEPAIYRINDDLEYSVEIYEWSGTSWEPYVSDDVQVQFYMMSPYVLKTLSTDQKGHYSAEFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 510
            ++GN +    +S+WVF E G L+   V HH+VGE+  P  Y + D +EYS+ I + S   W P+  DD+Q++F  + P+V +T    + G YS +FK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMMAG F+F++V L+ K
Sbjct:  270 QTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIEQLSNGKWVPFDGDDIQLEFVRIDPFV-RTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFLFSVVFLHMK 435          
BLAST of EY756260 vs. ExPASy Swiss-Prot
Match: OST48_PONAB (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Pongo abelii GN=DDOST PE=2 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 5.524e-45
Identity = 85/167 (50.90%), Postives = 115/167 (68.86%), Query Frame = 1
Query:   10 RSGNDQFLTEISKWVFHERGHLKDVNVRHHKVGESDEPAIYRINDDLEYSVEIYEWSGTSWEPYVSDDVQVQFYMMSPYVLKTLSTDQKGHYSAEFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 510
            ++GN +    +S+WVF E G L+   V HH+VGE+  P  Y + D +EYS+ I + S   W P+  DD+Q++F  + P+V +T    + G YS +FK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMM G FIF+IV L+ K
Sbjct:  268 QTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFV-RTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK 433          
BLAST of EY756260 vs. ExPASy Swiss-Prot
Match: OST48_HUMAN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens GN=DDOST PE=1 SV=4)

HSP 1 Score: 181.03 bits (458), Expect = 5.524e-45
Identity = 85/167 (50.90%), Postives = 115/167 (68.86%), Query Frame = 1
Query:   10 RSGNDQFLTEISKWVFHERGHLKDVNVRHHKVGESDEPAIYRINDDLEYSVEIYEWSGTSWEPYVSDDVQVQFYMMSPYVLKTLSTDQKGHYSAEFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 510
            ++GN +    +S+WVF E G L+   V HH+VGE+  P  Y + D +EYS+ I + S   W P+  DD+Q++F  + P+V +T    + G YS +FK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMM G FIF+IV L+ K
Sbjct:  285 QTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFV-RTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK 450          
BLAST of EY756260 vs. ExPASy Swiss-Prot
Match: OST48_DANRE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Danio rerio GN=ddost PE=2 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 5.524e-45
Identity = 84/167 (50.30%), Postives = 114/167 (68.26%), Query Frame = 1
Query:   10 RSGNDQFLTEISKWVFHERGHLKDVNVRHHKVGESDEPAIYRINDDLEYSVEIYEWSGTSWEPYVSDDVQVQFYMMSPYVLKTLSTDQKGHYSAEFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 510
            ++GN      +S+WVF E G L+  +V HH VGES  PA Y + D +EY + I   SG  W P+  DD+Q++F  + P+V +T      G YS +FK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+A+PYY SAFSMMAG F+F++V L+ +
Sbjct:  270 QTGNQDLAEALSRWVFKEAGVLRVGDVTHHPVGESTPPAAYTVTDLVEYGIVIEMLSGGKWVPFDGDDIQLEFVRIDPFV-RTYLKKNGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAFPYYASAFSMMAGLFVFSVVFLHMR 435          
BLAST of EY756260 vs. ExPASy Swiss-Prot
Match: OST48_XENLA (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Xenopus laevis GN=ddost PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 7.215e-45
Identity = 85/167 (50.90%), Postives = 115/167 (68.86%), Query Frame = 1
Query:   10 RSGNDQFLTEISKWVFHERGHLKDVNVRHHKVGESDEPAIYRINDDLEYSVEIYEWSGTSWEPYVSDDVQVQFYMMSPYVLKTLSTDQKGHYSAEFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 510
            ++GN +    +S+WVF E G L+   V HH+VGES  P+ Y + D +EYS+ I + S   W P+  DD+Q++F  + P+V +T      G YS +FK+PDVYGVFQFKV+Y RLGYT L  + QI VRP +H +YERF+P+AYPYY SAFS+M G FIF+IV L+ K
Sbjct:  267 KTGNYELAMALSRWVFKEEGVLRVGEVSHHRVGESSPPSAYTVTDLVEYSIVIEKLSDGKWVPFDGDDIQLEFVRIDPFV-RTFLKKNGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSTTQISVRPLQHTQYERFIPSAYPYYASAFSVMFGLFIFSIVFLHMK 432          
BLAST of EY756260 vs. ExPASy Swiss-Prot
Match: OST48_BOVIN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Bos taurus GN=DDOST PE=2 SV=2)

HSP 1 Score: 179.489 bits (454), Expect = 1.607e-44
Identity = 84/167 (50.30%), Postives = 115/167 (68.86%), Query Frame = 1
Query:   10 RSGNDQFLTEISKWVFHERGHLKDVNVRHHKVGESDEPAIYRINDDLEYSVEIYEWSGTSWEPYVSDDVQVQFYMMSPYVLKTLSTDQKGHYSAEFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 510
            ++GN +    +S+WVF E G L+   V HH+VGE+  P  Y + D +EYS+ I + S   W P+  DD+Q++F  + P+V +T    + G YS +FK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMM G FIF++V L+ K
Sbjct:  268 QTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIEQLSDGKWVPFDGDDIQLEFVRIDPFV-RTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSVVFLHMK 433          
BLAST of EY756260 vs. ExPASy Swiss-Prot
Match: OST48_CANFA (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Canis familiaris GN=DDOST PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.742e-44
Identity = 84/167 (50.30%), Postives = 114/167 (68.26%), Query Frame = 1
Query:   10 RSGNDQFLTEISKWVFHERGHLKDVNVRHHKVGESDEPAIYRINDDLEYSVEIYEWSGTSWEPYVSDDVQVQFYMMSPYVLKTLSTDQKGHYSAEFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 510
            ++GN +    +S+WVF E G L+   V HH+VGE+  P  Y + D +EYS+ I + S   W P+  DD+Q++F  + P+V +T    + G YS +FK+PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMM G FIF+ V L+ K
Sbjct:  274 QTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIEQLSNGRWVPFDGDDIQLEFVRIDPFV-RTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLHSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSTVFLHMK 439          
BLAST of EY756260 vs. ExPASy Swiss-Prot
Match: OST48_PIG (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Sus scrofa GN=DDOST PE=1 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 4.676e-44
Identity = 84/167 (50.30%), Postives = 113/167 (67.66%), Query Frame = 1
Query:   10 RSGNDQFLTEISKWVFHERGHLKDVNVRHHKVGESDEPAIYRINDDLEYSVEIYEWSGTSWEPYVSDDVQVQFYMMSPYVLKTLSTDQKGHYSAEFKVPDVYGVFQFKVEYQRLGYTSLSLSKQIPVRPYRHNEYERFLPAAYPYYGSAFSMMAGFFIFTIVHLYSK 510
            ++GN +    +S+WVF E G L+   V HH+VGE   P  Y + D +EYS+ I + S   W P+  DD+Q++F  + P+V +T    + G YS +FK PDVYGVFQFKV+Y RLGYT L  S Q+ VRP +H +YERF+P+AYPYY SAFSMM G FIF++V L+ K
Sbjct:  268 QTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGEKAPPNAYTVTDLVEYSIVIEQLSEGRWVPFDGDDIQLEFVRIDPFV-RTFLKRKGGKYSVQFKFPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMVGLFIFSVVFLHMK 433          
The following BLAST results are available for this feature:
BLAST of EY756260 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
OST48_XENTR4.230e-4550.30Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_MOUSE4.230e-4551.50Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_RAT5.524e-4550.30Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_PONAB5.524e-4550.90Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_HUMAN5.524e-4550.90Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_DANRE5.524e-4550.30Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_XENLA7.215e-4550.90Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_BOVIN1.607e-4450.30Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_CANFA2.742e-4450.30Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
OST48_PIG4.676e-4450.30Dolichyl-diphosphooligosaccharide--protein glycosy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D11-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756260 ID=EY756260|Name=EY756260|organism=Citrus sinensis|type=EST|length=724bp
CCACGCGTCCGATCAGGTAATGACCAGTTTTTGACAGAAATTAGCAAATG
GGTTTTCCATGAAAGAGGTCATCTTAAGGATGTGAATGTGAGACACCACA
AAGTTGGAGAATCAGATGAACCTGCAATTTACAGGATCAATGATGACTTG
GAATACTCGGTTGAGATTTATGAGTGGTCTGGAACAAGCTGGGAACCATA
TGTTTCAGATGATGTTCAAGTGCAGTTTTACATGATGAGCCCCTATGTTT
TGAAAACCTTATCAACTGACCAGAAGGGTCACTATTCTGCTGAATTCAAG
GTTCCAGATGTTTATGGAGTCTTCCAATTCAAGGTCGAGTACCAAAGACT
AGGATACACCAGCTTATCCCTATCAAAACAGATTCCAGTCAGGCCCTACA
GACACAATGAATACGAAAGATTTTTACCAGCAGCTTACCCATATTATGGA
TCAGCATTTTCTATGATGGCTGGTTTCTTTATCTTCACCATCGTTCACCT
TTACAGCAAGTAGATTTTTACTTTCGATGCTGAGAGAAACCATAGTGTTC
GGAGCAGGATTAGATATTTTTTATTATGCCATGAGAAGAATATTTATCAT
GTTAACAACTTGTCTTCAAGTTGTCCAATTATAATTTTTCAGGCACACTG
GTCTTATTGCTTGCCCCTTTGAATTTAATATACACTTTTAATGTCACATA
ATACTTCAAAAAAAAAAAAAAAAA
back to top