EY756251

Overview
NameEY756251
Unique NameEY756251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:702..1113. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU1_SOYBN (Elongation factor Tu, chloroplastic OS=Glycine max GN=TUFA PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.354e-44
Identity = 87/93 (93.55%), Postives = 91/93 (97.85%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTG+V+SIMNDKDEES MV+PGDRVKMVVELI+PVACEQGMRFAIREGGKTVGAGVIQSIIE
Sbjct:  387 AIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGKVTSIMNDKDEESTMVLPGDRVKMVVELIVPVACEQGMRFAIREGGKTVGAGVIQSIIE 479          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU2_SOYBN (Elongation factor Tu, chloroplastic OS=Glycine max GN=TUFB1 PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.768e-44
Identity = 86/93 (92.47%), Postives = 91/93 (97.85%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRHSPFF+GYRPQFYMRTTDVTG+V+ IMNDKDEESKMVMPGDRVK+VVELI+PVACEQGMRFAIREGGKTVGAGVIQSIIE
Sbjct:  387 AIVYVLKKEEGGRHSPFFSGYRPQFYMRTTDVTGKVTEIMNDKDEESKMVMPGDRVKLVVELIVPVACEQGMRFAIREGGKTVGAGVIQSIIE 479          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_ARATH (Elongation factor Tu, chloroplastic OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 3.335e-43
Identity = 83/93 (89.25%), Postives = 90/93 (96.77%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A +YVLKKEEGGRHSPFFAGYRPQFYMRTTDVTG+V+ IMNDKDEESKMVMPGDRVK+VVELI+PVACEQGMRFAIREGGKTVGAGVI +I+E
Sbjct:  384 AIIYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGKVTKIMNDKDEESKMVMPGDRVKIVVELIVPVACEQGMRFAIREGGKTVGAGVIGTILE 476          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_PEA (Elongation factor Tu, chloroplastic OS=Pisum sativum GN=tufA PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 7.429e-43
Identity = 85/93 (91.40%), Postives = 90/93 (96.77%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTG+V+SIMNDKDEESKMVMPGDRVK+VVELI+PVA EQGMRFAIREGGKTVGAGVI +IIE
Sbjct:  396 AIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGKVTSIMNDKDEESKMVMPGDRVKIVVELIVPVAIEQGMRFAIREGGKTVGAGVIGAIIE 488          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTUB_NICSY (Elongation factor TuB, chloroplastic OS=Nicotiana sylvestris GN=TUFB PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 9.702e-43
Identity = 84/93 (90.32%), Postives = 88/93 (94.62%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTG+V+ IM+DK EESKMVMPGDRV MVVELIMPVACEQGMRFAIREGGKTVGAGVIQ I+E
Sbjct:  393 ALVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGKVTVIMSDKGEESKMVMPGDRVNMVVELIMPVACEQGMRFAIREGGKTVGAGVIQKILE 485          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_TOBAC (Elongation factor Tu, chloroplastic OS=Nicotiana tabacum GN=TUFA PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 3.687e-42
Identity = 83/93 (89.25%), Postives = 87/93 (93.55%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRHSPFF+GYRPQFYMRTTDVTG+V+SI  DK EESKMVMPGDRV +VVELIMPVACEQGMRFAIREGGKTVGAGVIQ IIE
Sbjct:  386 AIVYVLKKEEGGRHSPFFSGYRPQFYMRTTDVTGKVTSITTDKGEESKMVMPGDRVNLVVELIMPVACEQGMRFAIREGGKTVGAGVIQKIIE 478          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTUA_NICSY (Elongation factor TuA, chloroplastic OS=Nicotiana sylvestris GN=TUFA PE=2 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 3.687e-42
Identity = 83/93 (89.25%), Postives = 87/93 (93.55%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRHSPFF+GYRPQFYMRTTDVTG+V+SI  DK EESKMVMPGDRV +VVELIMPVACEQGMRFAIREGGKTVGAGVIQ IIE
Sbjct:  386 AIVYVLKKEEGGRHSPFFSGYRPQFYMRTTDVTGKVTSITTDKGEESKMVMPGDRVNLVVELIMPVACEQGMRFAIREGGKTVGAGVIQKIIE 478          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_OSTTA (Elongation factor Tu, chloroplastic OS=Ostreococcus tauri GN=tufA PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 2.315e-36
Identity = 69/93 (74.19%), Postives = 83/93 (89.25%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            A VYVLKKEEGGRH+PFF GYRPQFY+RTTDVTG++ S ++D+ +E+ MVMPGDRVKMVVELI P+A E GMRFAIREGG+TVGAGV+ SI++
Sbjct:  317 AQVYVLKKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFISDEGDEATMVMPGDRVKMVVELIQPIAIENGMRFAIREGGRTVGAGVVSSILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_SYNJB (Elongation factor Tu OS=Synechococcus sp. GN=tuf PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 5.701e-35
Identity = 68/93 (73.12%), Postives = 79/93 (84.95%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG +SS   D   + +MVMPGDRVKM VELI P+A EQGMRFAIREGG+TVGAGV+  I++
Sbjct:  317 SEVYVLKKEEGGRHTPFFAGYRPQFYVRTTDVTGTISSFTADDGSQPEMVMPGDRVKMTVELIQPIAIEQGMRFAIREGGRTVGAGVVSKILK 409          
BLAST of EY756251 vs. ExPASy Swiss-Prot
Match: EFTU_EUGGR (Elongation factor Tu, chloroplastic OS=Euglena gracilis GN=tufA PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 2.166e-34
Identity = 65/93 (69.89%), Postives = 80/93 (86.02%), Query Frame = 2
Query:    5 ASVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRVKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 283
            + VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG++ S  +D D  ++MVMPGDR+KM VELI P+A E+GMRFAIREGG+TVGAGV+ SII+
Sbjct:  317 SQVYILTKEEGGRHTPFFEGYRPQFYVRTTDVTGKIESFRSDNDNPAQMVMPGDRIKMKVELIQPIAIEKGMRFAIREGGRTVGAGVVLSIIQ 409          
The following BLAST results are available for this feature:
BLAST of EY756251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU1_SOYBN1.354e-4493.55Elongation factor Tu, chloroplastic OS=Glycine max... [more]
EFTU2_SOYBN1.768e-4492.47Elongation factor Tu, chloroplastic OS=Glycine max... [more]
EFTU_ARATH3.335e-4389.25Elongation factor Tu, chloroplastic OS=Arabidopsis... [more]
EFTU_PEA7.429e-4391.40Elongation factor Tu, chloroplastic OS=Pisum sativ... [more]
EFTUB_NICSY9.702e-4390.32Elongation factor TuB, chloroplastic OS=Nicotiana ... [more]
EFTU_TOBAC3.687e-4289.25Elongation factor Tu, chloroplastic OS=Nicotiana t... [more]
EFTUA_NICSY3.687e-4289.25Elongation factor TuA, chloroplastic OS=Nicotiana ... [more]
EFTU_OSTTA2.315e-3674.19Elongation factor Tu, chloroplastic OS=Ostreococcu... [more]
EFTU_SYNJB5.701e-3573.12Elongation factor Tu OS=Synechococcus sp. GN=tuf P... [more]
EFTU_EUGGR2.166e-3469.89Elongation factor Tu, chloroplastic OS=Euglena gra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756251 ID=EY756251|Name=EY756251|organism=Citrus sinensis|type=EST|length=412bp
CCACGCGTCCGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCAC
CTTTCTTTGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTG
ACTGGAAGGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGAT
GGTTATGCCTGGCGACCGTGTCAAGATGGTTGTGGAGCTTATTATGCCAG
TGGCTTGTGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACT
GTTGGAGCTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACT
TTCATGGGCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCA
TATTCTTAAGTTTTTATGGAATTAGTTTCACCATTCTAGGAAAAAAAAAA
AAAAAAAAAAAA
back to top