EY756250

Overview
NameEY756250
Unique NameEY756250
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length476
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5137 contig Csv1_Contig5137:1..454. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756250 vs. ExPASy Swiss-Prot
Match: Y1934_ARATH (Uncharacterized protein At1g09340, chloroplastic OS=Arabidopsis thaliana GN=At1g09340 PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 2.070e-38
Identity = 74/81 (91.36%), Postives = 77/81 (95.06%), Query Frame = 1
Query:   13 ELVFSNPKEFDFGKKKAFPFRDQHFFASVEKAKHVLGWKPEFDLVEGLADSYNLDFGRGTYRKEADFSTDDMILGKKLVLQ 255
            E+V  NPKEFDFGKKKAFPFRDQHFFASVEKAKHVLGWKPEFDLVEGL DSYNLDFGRGT+RKEADF+TDDMIL KKLVLQ
Sbjct:  298 EIVHYNPKEFDFGKKKAFPFRDQHFFASVEKAKHVLGWKPEFDLVEGLTDSYNLDFGRGTFRKEADFTTDDMILSKKLVLQ 378          
The following BLAST results are available for this feature:
BLAST of EY756250 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y1934_ARATH2.070e-3891.36Uncharacterized protein At1g09340, chloroplastic O... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D01-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756250 ID=EY756250|Name=EY756250|organism=Citrus sinensis|type=EST|length=476bp
CCACGCGTCCGTGAACTTGTGTTCTCCAACCCCAAAGAGTTTGACTTTGG
TAAAAAGAAGGCTTTTCCATTCAGGGACCAGCATTTCTTTGCGTCAGTTG
AGAAGGCAAAGCATGTGCTCGGATGGAAACCTGAGTTTGACCTGGTGGAA
GGTCTTGCAGACTCATACAACCTAGACTTTGGCAGGGGCACATACAGGAA
AGAGGCTGATTTCTCCACAGATGACATGATTCTCGGCAAGAAACTCGTTC
TTCAGGCCTAGTTCATTCACACATTTCCTAGGGTTTTTTTTTTTTCCCTC
CTTATAGTTACTTTGTTGATCATTTTCATCCAAGCTCTAGGCTGCCTACT
GTTCATGGTTTATGGTTTCAACTGAAAATATTTGAGTTCCACATGTATCG
TAAACCTTGTATGAGAATTAATAAATCAATGCAAGTCATTTTCTCGAAAA
AAAAAAAAAAAAAANAANNNAAAAAG
back to top