EY756249

Overview
NameEY756249
Unique NameEY756249
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length591
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13318 contig Csv1_Contig13318:1..591. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756249 vs. ExPASy Swiss-Prot
Match: C3H24_ORYSJ (Zinc finger CCCH domain-containing protein 24 OS=Oryza sativa subsp. japonica GN=Os03g0698800 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.516e-14
Identity = 46/97 (47.42%), Postives = 63/97 (64.95%), Query Frame = 1
Query:   55 DWSIKGDELELLRRSSSCDLRNNNHEEPDLSWIHSIVKESPPE--MMKEKTANPVVTTAL------SGEALNSNSQADSFDH-SVIGAWLEQMQLDQ 318
            DW + G+EL  LRRSSS +LR+   ++PDLSW+H++VKESPPE  +   ++ N V  + L      +GE  + N+  D  D  +VIGA LEQMQLDQ
Sbjct:  662 DWGVNGEELGKLRRSSSFELRSGG-DDPDLSWVHTLVKESPPEKQVTTAESINSVGPSPLMPPSVSNGEGPSLNAPLDGHDQAAVIGALLEQMQLDQ 757          
BLAST of EY756249 vs. ExPASy Swiss-Prot
Match: C3H67_ORYSJ (Zinc finger CCCH domain-containing protein 67 OS=Oryza sativa subsp. japonica GN=Os12g0515500 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 7.972e-11
Identity = 40/103 (38.83%), Postives = 58/103 (56.31%), Query Frame = 1
Query:   55 DWSIKGDELELLRRSSSCDLRN---NNHEEPDLSWIHSIVKESPPEMMKEKTANPVVTTALSGEALNSNSQADSFDH---------SVIGAWLEQMQLDQLVV 327
            DW    +EL  L+R SS +LR+   N + EPDLSW++++VKE  PE M        +TT  + +++    Q  S DH          VI +WLEQ+QLD++VV
Sbjct:  525 DWGADDEELGRLKRCSSFELRSGAANGNHEPDLSWVNTLVKEPTPEKM--------MTTTSAMDSIGILGQNTSRDHIVGGEDDTAGVISSWLEQLQLDEMVV 619          
The following BLAST results are available for this feature:
BLAST of EY756249 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
C3H24_ORYSJ4.516e-1447.42Zinc finger CCCH domain-containing protein 24 OS=O... [more]
C3H67_ORYSJ7.972e-1138.83Zinc finger CCCH domain-containing protein 67 OS=O... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-C12-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756249 ID=EY756249|Name=EY756249|organism=Citrus sinensis|type=EST|length=591bp
CCACGCGTCCGAAATTCTTCTTGGTCTAAATGGGGTTCTCCAAGTGGAAA
ATTGGACTGGTCTATTAAAGGAGATGAATTGGAATTGTTGCGAAGGTCAT
CTTCTTGTGATCTTCGGAACAACAACCATGAGGAGCCTGATCTATCTTGG
ATCCATTCTATAGTCAAGGAATCACCACCTGAGATGATGAAAGAGAAAAC
AGCAAATCCAGTTGTCACTACTGCATTATCTGGTGAGGCTTTGAATTCTA
ATTCTCAAGCTGATTCTTTTGATCATTCGGTCATTGGGGCATGGCTTGAG
CAGATGCAGCTTGATCAGCTCGTAGTCTAGTGAAGTTGATTTCATTTCAA
TTCAGTTGCCCAATTGAAGATTTCTCAAGGATGGGTAGGAAGTAGCCTTT
CAATGGGCGGCATAAGATTAAGAAACTTAGTCCAGTATTCTGATCAGTGG
ATGGTAATATTCTTTTTGAGGGATTCAATTGTAGTGAGCCAAGATGGTTC
CTTTGAACGATGTAAAAGCGAATTCGAAGTTATTAATTAATATATTTCAA
TACCCCTTTAATTTTAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top