EY756245

Overview
NameEY756245
Unique NameEY756245
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length883
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1408 contig Csv1_Contig1408:12..896. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756245 vs. ExPASy Swiss-Prot
Match: RTNLA_ARATH (Reticulon-like protein B1 OS=Arabidopsis thaliana GN=RTNLB1 PE=1 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 2.784e-67
Identity = 103/146 (70.55%), Postives = 125/146 (85.62%), Query Frame = 1
Query:  211 AFKSKVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSGVGNC 648
            + KSKV+RLFGRE+P+H VLG GKPADIF+W+NKK+S GVLGGATA WV+FEL+EYHL+TL+CH+ I+ LAVLFLWSNA+ FINKSPP+IP V +PE+ +L+ AS LR EINR  + LREIASGRDLKKFL  IAGLW+LS +G C
Sbjct:   65 SMKSKVYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWVLSILGGC 210          

HSP 2 Score: 56.225 bits (134), Expect = 2.784e-67
Identity = 26/40 (65.00%), Postives = 31/40 (77.50%), Query Frame = 3
Query:  651 NFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIENQK 770
            NF+TL YI  VLL TVP+ Y+KYEDK+D  GEKA IE +K
Sbjct:  212 NFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIELKK 251          

HSP 3 Score: 22.7126 bits (47), Expect = 2.784e-67
Identity = 9/12 (75.00%), Postives = 10/12 (83.33%), Query Frame = 2
Query:  773 YAVFDEKVLKKV 808
            YAV DEKVL K+
Sbjct:  253 YAVLDEKVLSKI 264          
BLAST of EY756245 vs. ExPASy Swiss-Prot
Match: RTNLB_ARATH (Reticulon-like protein B2 OS=Arabidopsis thaliana GN=RTNLB2 PE=1 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.160e-65
Identity = 99/146 (67.81%), Postives = 125/146 (85.62%), Query Frame = 1
Query:  211 AFKSKVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSGVGNC 648
            + KSKV+RLFGRE+P+H VLG GKPADIF+W++KK+S GV GGAT  WVLFEL+EYHL+TL+CH+ I++LAVLFLWSNA+ FI+KSPP+IP V +PE+ +L+ AS LR EINR ++ LREIASGRD+KKFL  IAGLW+LS +G C
Sbjct:   61 SLKSKVYRLFGRERPVHKVLGGGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSLREIASGRDIKKFLSAIAGLWVLSILGGC 206          

HSP 2 Score: 55.8398 bits (133), Expect = 1.160e-65
Identity = 25/40 (62.50%), Postives = 32/40 (80.00%), Query Frame = 3
Query:  651 NFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIENQK 770
            +F+TL YI  VLL TVP+ Y+KYEDK+DS+GEKA  E +K
Sbjct:  208 SFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEKAMAELKK 247          
BLAST of EY756245 vs. ExPASy Swiss-Prot
Match: RTNLD_ARATH (Reticulon-like protein B4 OS=Arabidopsis thaliana GN=RTNLB4 PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 5.099e-57
Identity = 102/158 (64.56%), Postives = 123/158 (77.85%), Query Frame = 1
Query:  211 AFKSKVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSGVGNCATS*HYSTLYLF 684
            +FKSK++RLFGREKP+H VLG GKPADIFLWRNKK+S GVLG  TA WVLFEL EYHL+  +CH +I +LA LFLWSNA TFI+KS P IP V +PE  +L+  S LR EINR L +LR IASG+D+KKF+ VIAGLW+LS +G+C     Y+ L LF
Sbjct:   44 SFKSKIYRLFGREKPVHKVLGGGKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNACTFIHKSTPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGKDVKKFILVIAGLWVLSIIGSC-----YNFLTLF 196          

HSP 2 Score: 30.8018 bits (68), Expect = 5.099e-57
Identity = 13/18 (72.22%), Postives = 16/18 (88.89%), Query Frame = 2
Query:  773 YAVFDEKVLKKVLSXIPK 826
            YAV DEKVL+KV+S IP+
Sbjct:  232 YAVLDEKVLRKVISKIPR 249          
BLAST of EY756245 vs. ExPASy Swiss-Prot
Match: RTNLC_ARATH (Reticulon-like protein B3 OS=Arabidopsis thaliana GN=RTNLB3 PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.090e-55
Identity = 107/161 (66.46%), Postives = 128/161 (79.50%), Query Frame = 1
Query:  211 AFKSKVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSGVG---NCATS*HYSTLYLF 684
            + K+K++RLFGRE+P+H + G GKPADIFLWRNKK+S GVLG AT  W+LFELLEY+L+TL  HISIL+LAVLFLWS+ASTFI+KSP  IP V +PE  VL+ AS LR EINR   VLR+IASGRDLKKFL VIAGLW+LS VG   N  T  + +T+ LF
Sbjct:   40 SLKTKIYRLFGREQPLHKLFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLF 200          

HSP 2 Score: 26.9498 bits (58), Expect = 2.090e-55
Identity = 12/18 (66.67%), Postives = 13/18 (72.22%), Query Frame = 2
Query:  773 YAVFDEKVLKKVLSXIPK 826
            Y  FD KVL KV+S IPK
Sbjct:  228 YVEFDVKVLSKVMSKIPK 245          
BLAST of EY756245 vs. ExPASy Swiss-Prot
Match: RTNLE_ARATH (Reticulon-like protein B5 OS=Arabidopsis thaliana GN=RTNLB5 PE=1 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.213e-52
Identity = 105/203 (51.72%), Postives = 140/203 (68.97%), Query Frame = 1
Query:   85 MAEHAPEHESSDKSLVEKITXXXXXXXXXXXXXXXXXXXXXX-AFKSKVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSGVGNCATS*HYSTLYLFCY 690
            MAE   +   +++SL+EKI+                       A K+K++R+FGREKP+H VLG GKPAD+FLWR+KK+S  VLG ATA+WVLFEL+EYHL++L+CHISIL+L  LFLWSNA T INK+ P+IP + +PE+  L  AS+LR E+N+A  +LR IA GRDLKKFL V+ GLW++S VGN     ++ TL   C+
Sbjct:    1 MAEEIEKSVPTEESLMEKISEKIHHHDSSSSSESEYEKPDSPSAVKAKIYRMFGREKPVHKVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTLINKTSPQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWF---NFLTLVYICF 200          

HSP 2 Score: 23.483 bits (49), Expect = 1.213e-52
Identity = 9/12 (75.00%), Postives = 10/12 (83.33%), Query Frame = 2
Query:  773 YAVFDEKVLKKV 808
            Y VFDEKVL K+
Sbjct:  232 YVVFDEKVLSKI 243          
BLAST of EY756245 vs. ExPASy Swiss-Prot
Match: RTNLF_ARATH (Reticulon-like protein B6 OS=Arabidopsis thaliana GN=RTNLB6 PE=1 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 9.154e-50
Identity = 103/203 (50.74%), Postives = 134/203 (66.01%), Query Frame = 1
Query:   85 MAEHAPEHESSDKSLVEKITXXXXXXXXXXXXXXXXXXXXXX-AFKSKVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSGVGNCATS*HYSTLYLFCY 690
            MAE   +    ++SL+EKI                        A K+K++RLFGREKP+H VLG G PAD+FLWR+KK+SA VLG ATA+WVLFEL+EYH ++LVCHI I +LA LFL SNA  F+NK+PP+IP + + E+  L   SALR E+N+A  +LR IA GRDLKKFL V+ GLW++S VGN     ++ TL   C+
Sbjct:    1 MAEELEKSMHKEESLMEKIADKIHDHDSSSSSDSEHEKPESPSALKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLSNAHAFMNKTPPKIPEIHIKEEHFLMIVSALRNELNQAFVILRSIALGRDLKKFLMVVFGLWIISVVGNWF---NFLTLVYICF 200          

HSP 2 Score: 22.3274 bits (46), Expect = 9.154e-50
Identity = 9/12 (75.00%), Postives = 10/12 (83.33%), Query Frame = 2
Query:  773 YAVFDEKVLKKV 808
            Y VFDEKVL K+
Sbjct:  232 YMVFDEKVLSKL 243          
BLAST of EY756245 vs. ExPASy Swiss-Prot
Match: RTNLH_ARATH (Reticulon-like protein B8 OS=Arabidopsis thaliana GN=RTNLB8 PE=1 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.187e-37
Identity = 73/143 (51.05%), Postives = 101/143 (70.63%), Query Frame = 1
Query:  220 SKVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSGVGNC 648
            S+  RLF R+KPIHHVLG GK AD+ LWRNKKISA VL GATA+WVLFE + +H ++LVC+  +L +   F+WSNAS F+N+S   +P + LP+ F  E   A+  E+NR L  L+++A   +LK+FL  + GLW+ + VG+C
Sbjct:   40 SRFNRLFDRQKPIHHVLGGGKSADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWSNASGFLNRSQSRVPRLVLPKDFFAEVGVAVGKEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVGSC 182          
BLAST of EY756245 vs. ExPASy Swiss-Prot
Match: RTNLG_ARATH (Reticulon-like protein B7 OS=Arabidopsis thaliana GN=RTNLB7 PE=2 SV=2)

HSP 1 Score: 144.436 bits (363), Expect = 7.963e-34
Identity = 70/140 (50.00%), Postives = 98/140 (70.00%), Query Frame = 1
Query:  226 VFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSGVGN 645
            ++R+FGRE+PIH VLG GKPAD+ LWR+KK++ G+L   T +W+LF      L+T +C  SIL L + FLWSNA   +NKSP  +  + +PEK +L+ ASA+ +E+N A A LR IA  RD+K F+  + GLWL+S +GN
Sbjct:   51 IYRMFGRERPIHMVLGGGKPADVLLWRDKKVTLGLLSAVTVIWLLFGFGGRRLLTSLCRGSILFLLLSFLWSNA---LNKSPENMMDIYIPEKPLLQAASAMTFELNCAFATLRSIALERDIKNFVMAVIGLWLVSVIGN 187          
BLAST of EY756245 vs. ExPASy Swiss-Prot
Match: RTNLI_ARATH (Reticulon-like protein B9 OS=Arabidopsis thaliana GN=RTNLB9 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.091e-30
Identity = 56/140 (40.00%), Postives = 82/140 (58.57%), Query Frame = 1
Query:  223 KVFRLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSGVG 642
            K  +LF R++ IH + G GK ADI LWR  KI+A ++ G + +W L E++EY+ ITL+CH S+ S+   F+WS AS F+N   P IP V L E    + A +     N+ L  L ++A GRD   F      L+++S +G
Sbjct:   19 KTTKLFTRQRSIHSIFGGGKVADILLWREPKIAATLVIGVSILWFLMEVVEYNFITLICHASMTSMLFFFIWSTASDFLNWERPLIPEVVLDESSFKQLARSFHVRFNQILTKLLDVACGRDPPLFFLTTISLYIVSIIG 158          

HSP 2 Score: 40.0466 bits (92), Expect = 1.091e-30
Identity = 20/48 (41.67%), Postives = 29/48 (60.42%), Query Frame = 3
Query:  651 NFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIENQKHMQSLMKR 794
            NFV L +I FV + T+PV+YE YED +D+   K      + M+ L K+
Sbjct:  162 NFVNLLFIGFVSMQTLPVMYEMYEDDVDTAAGKL----MRKMKKLYKK 205          
BLAST of EY756245 vs. ExPASy Swiss-Prot
Match: RTNLL_ARATH (Reticulon-like protein B12 OS=Arabidopsis thaliana GN=RTNLB12 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.039e-25
Identity = 50/138 (36.23%), Postives = 82/138 (59.42%), Query Frame = 1
Query:  232 RLFGREKPIHHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSGVGN 645
            +LF R++ IH +LG G  AD+ LWR K +S G++    A W++FE   Y + TL+  + +L L++LFLWS +++ +N+  P +P   + E    E +  LR  +N+ L V  +IA  RD + +  V   L+LLS +G+
Sbjct:    7 KLFNRDRTIHEILGGGIVADVMLWRKKNVSVGIVTVTIASWMVFEAFAYTIFTLISSVLLLLLSILFLWSKSASILNRPSPPLPEFQISEAMAEEASIWLRIHVNKLLQVSHDIAMARDSELYTKVAVSLFLLSLIGS 144          

HSP 2 Score: 29.261 bits (64), Expect = 2.039e-25
Identity = 13/29 (44.83%), Postives = 19/29 (65.52%), Query Frame = 3
Query:  645 LCNFVTLFYIVFVLLHTVPVIYEKYEDKI 731
            L +F TL +   +++ TVP  YE+YED I
Sbjct:  145 LMDFQTLCHTSVLVVMTVPAFYERYEDYI 173          
The following BLAST results are available for this feature:
BLAST of EY756245 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
RTNLA_ARATH2.784e-6770.55Reticulon-like protein B1 OS=Arabidopsis thaliana ... [more]
RTNLB_ARATH1.160e-6567.81Reticulon-like protein B2 OS=Arabidopsis thaliana ... [more]
RTNLD_ARATH5.099e-5764.56Reticulon-like protein B4 OS=Arabidopsis thaliana ... [more]
RTNLC_ARATH2.090e-5566.46Reticulon-like protein B3 OS=Arabidopsis thaliana ... [more]
RTNLE_ARATH1.213e-5251.72Reticulon-like protein B5 OS=Arabidopsis thaliana ... [more]
RTNLF_ARATH9.154e-5050.74Reticulon-like protein B6 OS=Arabidopsis thaliana ... [more]
RTNLH_ARATH1.187e-3751.05Reticulon-like protein B8 OS=Arabidopsis thaliana ... [more]
RTNLG_ARATH7.963e-3450.00Reticulon-like protein B7 OS=Arabidopsis thaliana ... [more]
RTNLI_ARATH1.091e-3040.00Reticulon-like protein B9 OS=Arabidopsis thaliana ... [more]
RTNLL_ARATH2.039e-2536.23Reticulon-like protein B12 OS=Arabidopsis thaliana... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-C08-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756245 ID=EY756245|Name=EY756245|organism=Citrus sinensis|type=EST|length=883bp
CCACGCGTCCGGCTCTCTCTCGTTCTAGAGTCTAGTACATTTTTCAATTC
ATTTTCATCGGCGCTTACTCGGCGGCAGAGATCTATGGCGGAACATGCAC
CTGAGCACGAATCATCCGACAAATCACTGGTGGAGAAGATCACGGATAAG
ATCCATGGCCACGACTCCTCGTCATCTGACTCCGATGACGACAAGCCGTC
GTCTATTGACGCCTTTAAGTCCAAAGTATTCAGGCTCTTCGGAAGAGAAA
AACCTATTCACCATGTCCTCGGAGCTGGAAAACCTGCTGATATTTTCCTA
TGGAGGAACAAGAAAATATCTGCTGGTGTGCTAGGTGGAGCCACTGCAAT
GTGGGTTCTCTTTGAGTTGCTGGAATACCATTTAATCACTTTGGTCTGCC
ATATATCGATTCTCTCTCTGGCTGTTCTCTTCCTGTGGTCCAATGCATCC
ACATTTATCAACAAATCACCGCCAGAGATTCCAGTTGTTACACTTCCTGA
GAAGTTTGTCCTTGAATTCGCCTCTGCCTTGAGGTATGAAATCAACCGAG
CCTTGGCTGTCCTGCGGGAAATTGCATCTGGAAGGGACTTGAAGAAGTTT
CTTGGTGTCATTGCTGGCTTGTGGCTTTTGTCTGGTGTCGGTAATTGTGC
AACTTCGTGACATTATTCTACATTGTATTTGTTTTGCTACACACCGTGCC
CGTGATTTATGAGAAGTACGAGGACAAGATTGATTCATTTGGTGAGAAGG
CAACGATTGAGAATCAGAAGCATATGCAGTCTTTGATGAAAAGGTTTTGA
AGAAGGTTTTGAGTCNAATTCCAAAGGTGCATTGAAGAGGAAGATNNAAG
ACAGAATTNGTCAAGTTTTGAGAAACATGGTCT
back to top