EY756191

Overview
NameEY756191
Unique NameEY756191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length814
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756191 vs. ExPASy Swiss-Prot
Match: TRNH_DATST (Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.657e-59
Identity = 112/204 (54.90%), Postives = 144/204 (70.59%), Query Frame = 2
Query:   14 KGFPVSGNACDLKIRAQREKLMATVSSQFDGKLNILINNAGTFIPKXXXXXXXXXXXXVMTTNFESAYHLSQLAHPLLKXXXXXXXXXXXXVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIRVNSVAPWIIRTPLVDKVLKESTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTGQVICVDGGYSITGF 625
            KGF VSG  CD+   +QR+ LM +V+S F+GKLNILINNAGT IPK            +M TNFE++Y+L QLAHPLLK             AGVIA+P+ SI A+SKGA+NQ+TK+LACEWAKD IRVN+VAPWII TP+++   +  +  +    +I R P+ R GEP+EVSS+V +LC P ASY+TGQ+ICVDGGY++ GF
Sbjct:   64 KGFKVSGPVCDVSSISQRQTLMESVTSSFNGKLNILINNAGTTIPKEATNFTAEDYSIIMGTNFEASYNLCQLAHPLLKASGNASIVFNSSAAGVIAVPLSSIYAASKGAINQVTKSLACEWAKDSIRVNAVAPWIINTPIIEAACQVPSQKKNIESLIGRAPMKRAGEPSEVSSLVTYLCLPTASYITGQIICVDGGYTVNGF 267          
BLAST of EY756191 vs. ExPASy Swiss-Prot
Match: TRN1_DATST (Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 4.223e-55
Identity = 107/204 (52.45%), Postives = 142/204 (69.61%), Query Frame = 2
Query:   14 KGFPVSGNACDLKIRAQREKLMATVSSQFDGKLNILINNAGTFIPKXXXXXXXXXXXXVMTTNFESAYHLSQLAHPLLKXXXXXXXXXXXXVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIRVNSVAPWIIRTPLVDKVLKESTF-LEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTGQVICVDGGYSITG 622
            KG  V G+ CDL  R +R+KLM TV+  FDGKLNIL+NNAG  I K            +M TNFE+AYHLSQ+A+PLLK            +AG  A+P  S+ ++SKGA+NQ+TK+LACEWAKD IRVNSVAP +I TPLV+  +K++    E+ +  I++TP+ R G+P EVS+++AFLCFPAASY+TGQ+I  DGG++  G
Sbjct:   68 KGLNVEGSVCDLLSRTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTANG 271          
BLAST of EY756191 vs. ExPASy Swiss-Prot
Match: TRNH1_ARATH (Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 3.346e-52
Identity = 108/204 (52.94%), Postives = 134/204 (65.69%), Query Frame = 2
Query:   14 KGFPVSGNACDLKIRAQREKLMATVSSQFDGKLNILINNAGTFIPKXXXXXXXXXXXXVMTTNFESAYHLSQLAHPLLKXXXXXXXXXXXXVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIRVNSVAPWIIRTPLVDKVLKESTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTGQVICVDGGYSITGF 625
            KGF V+G+ CD  +R +REKLM TVSS F GKL+ILINN G    K             ++TN ESAYHLSQLAHPLLK            +AGV++  + SI +++KGA+NQL +NLACEWA D IR N+VAP +I TPL + V  +    E    +I R P+ R GEP EVSS+VAFLC PAASY+TGQ ICVDGG ++ GF
Sbjct:   61 KGFQVTGSVCDASLRPEREKLMQTVSSMFGGKLDILINNLGAIRSKPTLDYTAEDFSFHISTNLESAYHLSQLAHPLLKASGCGNIIFMSSIAGVVSASVGSIYSATKGALNQLARNLACEWASDGIRANAVAPAVIATPLAEAVYDD----EFKKVVISRKPLGRFGEPEEVSSLVAFLCMPAASYITGQTICVDGGLTVNGF 260          
BLAST of EY756191 vs. ExPASy Swiss-Prot
Match: TRN2_DATST (Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.244e-48
Identity = 98/198 (49.49%), Postives = 131/198 (66.16%), Query Frame = 2
Query:   14 KGFPVSGNACDLKIRAQREKLMATVSSQFDGKLNILINNAGTFIPKXXXXXXXXXXXXVMTTNFESAYHLSQLAHPLLKXXXXXXXXXXXXVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIRVNSVAPWIIRTPLVDKVLKESTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTGQVICVDGG 607
            KGF V  + CDL  R++R++LM TV++ F GKLNIL+NNAG  I K            +M+ NFE+AYHLS LAHP LK            V+G +A+P  ++  ++KGAM+QLT+ LA EWAKD IRVN V P +I T LV+  +++    E  N++I R  + R GEP E++++VAFLCFPAASYVTGQ+I VDGG
Sbjct:   56 KGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGG 253          
BLAST of EY756191 vs. ExPASy Swiss-Prot
Match: TRN2_HYONI (Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.931e-48
Identity = 98/203 (48.28%), Postives = 131/203 (64.53%), Query Frame = 2
Query:   14 KGFPVSGNACDLKIRAQREKLMATVSSQFDGKLNILINNAGTFIPKXXXXXXXXXXXXVMTTNFESAYHLSQLAHPLLKXXXXXXXXXXXXVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIRVNSVAPWIIRTPLVDKVLKESTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTGQVICVDGGYSITG 622
            KGF V  + CDL  R++RE+ M TVS+ F GKLNIL+NNAG  I K            +M+ NFE+AYHLS LAHP LK            ++G  A+P  ++  ++KGAM+QLT+ LA EWAKD IRVN V P +I T +V+  +++    E  +++I R  + R GEP E+++VVAFLCFPAASYVTGQ+I VDGG+   G
Sbjct:   56 KGFNVEASVCDLSSRSEREEFMKTVSNHFHGKLNILVNNAGIVIYKEAKDYTMEDYSHIMSINFEAAYHLSVLAHPFLKASERGNVVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSMVEMTIQDPEQKENLDKLIDRCALRRMGEPKELAAVVAFLCFPAASYVTGQIIYVDGGFMANG 258          
BLAST of EY756191 vs. ExPASy Swiss-Prot
Match: BACC2_BACSU (Bacilysin biosynthesis oxidoreductase bacC OS=Bacillus subtilis GN=bacC PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 7.041e-18
Identity = 64/195 (32.82%), Postives = 91/195 (46.67%), Query Frame = 2
Query:   38 ACDLKIRAQREKLMATVSSQFDGKLNILINNAGTFIPKXXXXXXXXXXXXVMTTNFESAYHLSQLAHPLLKXXXXXXXXXXXXVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIRVNSVAPWIIRTPLVDKVL---KESTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTGQVICVDGGYS 613
            AC   IR+  +K          G L++LINNAG  I              V+  N    + +S+ A   +             V GV+A P      +SKG + QLT+++A ++AK  IRVN V P II TPL +K      E T  E         P+ R G+P E+++V+ FL    +SY+TG  I  DGGY+
Sbjct:   66 ACQNAIRSAVDKF---------GGLDVLINNAGIEIVAPIHEMELSNWNKVLNVNLTGMFLMSKHALKYMLKSGKGNIINTCSVGGVVAWPDIPAYNASKGGVLQLTRSMAVDYAKHNIRVNCVCPGIIDTPLNEKSFLENNEGTLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGYT 251          
BLAST of EY756191 vs. ExPASy Swiss-Prot
Match: BACC_BACSU (Bacilysin biosynthesis oxidoreductase bacC OS=Bacillus subtilis GN=bacC PE=3 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 2.049e-17
Identity = 59/173 (34.10%), Postives = 85/173 (49.13%), Query Frame = 2
Query:  104 GKLNILINNAGTFIPKXXXXXXXXXXXXVMTTNFESAYHLSQLAHPLLKXXXXXXXXXXXXVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIRVNSVAPWIIRTPLVDKVL---KESTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTGQVICVDGGYS 613
            G L++LINNAG  I              V+  N    + +S+ A   +             V G++A P      +SKG + QLTK++A ++AK +IRVN V P II TPL +K      E T  E         P+ R G+P E+++V+ FL    +SY+TG  I  DGGY+
Sbjct:   79 GGLDVLINNAGIEIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKGNIINTCSVGGLVAWPDIPAYNASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNEKSFLENNEGTLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGYT 251          
BLAST of EY756191 vs. ExPASy Swiss-Prot
Match: HDHA_ECOLI (7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.564e-17
Identity = 63/191 (32.98%), Postives = 96/191 (50.26%), Query Frame = 2
Query:   38 ACDLKIRAQRE-KLMATVSSQFDGKLNILINNAGTFIPKXXXXXXXXXXXXVMTTNFESAYHLSQLAHPLLKXXXXXXXXXXXXVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIRVNSVAPWIIRTPLVDKVLKESTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTGQVICVDGG 607
            AC   I +++E   +A  +    GK++IL+NNAG   PK                N  S +HLSQL  P ++            +A        +  ASSK A + L +N+A +  +  IRVN +AP  I T  +  V+     +EQ  +M+  TPI R G+P ++++   FLC PAAS+V+GQ++ V GG
Sbjct:   64 ACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRR-AYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPE--IEQ--KMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGG 249          
BLAST of EY756191 vs. ExPASy Swiss-Prot
Match: HDHA_ECO57 (7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.564e-17
Identity = 63/191 (32.98%), Postives = 96/191 (50.26%), Query Frame = 2
Query:   38 ACDLKIRAQRE-KLMATVSSQFDGKLNILINNAGTFIPKXXXXXXXXXXXXVMTTNFESAYHLSQLAHPLLKXXXXXXXXXXXXVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIRVNSVAPWIIRTPLVDKVLKESTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTGQVICVDGG 607
            AC   I +++E   +A  +    GK++IL+NNAG   PK                N  S +HLSQL  P ++            +A        +  ASSK A + L +N+A +  +  IRVN +AP  I T  +  V+     +EQ  +M+  TPI R G+P ++++   FLC PAAS+V+GQ++ V GG
Sbjct:   64 ACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRR-AYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPE--IEQ--KMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGG 249          
BLAST of EY756191 vs. ExPASy Swiss-Prot
Match: FABG_THEMA (3-oxoacyl-[acyl-carrier-protein] reductase OS=Thermotoga maritima GN=fabG PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.961e-17
Identity = 62/202 (30.69%), Postives = 100/202 (49.50%), Query Frame = 2
Query:   11 GKGFPVSGNACDLKIRAQREKLMATVSSQFDGKLNILINNAGTFIPKXXXXXXXXXXXXVMTTNFESAYHLSQLAHPLLKXXXXXXXXXXXXVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIRVNSVAPWIIRTPLVDKVLKESTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTGQVICVDGGYSI 616
            GK  P   N  D   R Q ++++  V  ++ G++++L+NNAG                 V+  N +  ++++Q+  P +             V G+   P  +  A+SK  +  +TK  A E A   IRVN+VAP  I TP+ +K+ +++         + R P+ R G+P EV+ V+ FL    +SYVTGQVI +DGG  I
Sbjct:   54 GKVDPYVLNVTD---RDQIKEVVEKVVQKY-GRIDVLVNNAGITRDALLVRMKEEDWDAVINVNLKGVFNVTQMVVPYMIKQRNGSIVNVSSVVGIYGNPGQTNYAASKAGVIGMTKTWAKELAGRNIRVNAVAPGFIETPMTEKLPEKAR-----ETALSRIPLGRFGKPEEVAQVILFLASDESSYVTGQVIGIDGGLVI 246          
The following BLAST results are available for this feature:
BLAST of EY756191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 81
Match NameE-valueIdentityDescription
TRNH_DATST1.657e-5954.90Tropinone reductase homolog OS=Datura stramonium P... [more]
TRN1_DATST4.223e-5552.45Tropinone reductase 1 OS=Datura stramonium GN=TR1 ... [more]
TRNH1_ARATH3.346e-5252.94Tropinone reductase homolog At1g07440 OS=Arabidops... [more]
TRN2_DATST2.244e-4849.49Tropinone reductase 2 OS=Datura stramonium GN=TR2 ... [more]
TRN2_HYONI2.931e-4848.28Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 P... [more]
BACC2_BACSU7.041e-1832.82Bacilysin biosynthesis oxidoreductase bacC OS=Baci... [more]
BACC_BACSU2.049e-1734.10Bacilysin biosynthesis oxidoreductase bacC OS=Baci... [more]
HDHA_ECOLI4.564e-1732.987-alpha-hydroxysteroid dehydrogenase OS=Escherichi... [more]
HDHA_ECO574.564e-1732.987-alpha-hydroxysteroid dehydrogenase OS=Escherichi... [more]
FABG_THEMA5.961e-1730.693-oxoacyl-[acyl-carrier-protein] reductase OS=Ther... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-F12-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756191 ID=EY756191|Name=EY756191|organism=Citrus sinensis|type=EST|length=814bp
CCACGCGTCCGGTAAGGGGTTTCCAGTGAGTGGCAATGCATGTGACCTGA
AAATTAGAGCTCAGCGAGAGAAGCTTATGGCCACTGTCTCGTCTCAGTTT
GATGGCAAGCTCAACATCCTTATTAACAATGCTGGAACCTTCATACCTAA
GGAAACCACAGAATTTACCGAGGAGGATTTCTCAACTGTAATGACTACCA
ATTTTGAGTCTGCTTATCATCTGTCTCAACTTGCACACCCCCTCTTAAAA
TCATCAGGAAATGGAAACATCATATTTATATCCTCTGTTGCAGGCGTTAT
TGCTATACCAATGTGTTCCATCGCAGCATCGAGTAAAGGGGCGATGAATC
AACTCACAAAGAACTTGGCATGCGAGTGGGCAAAAGACAAAATTCGTGTT
AATTCAGTTGCACCATGGATCATTAGAACCCCACTCGTTGATAAAGTATT
GAAAGAATCTACGTTTCTGGAACAAGCAAATCGCATGATACTCCGTACTC
CTATCCCCCGACCTGGAGAACCTACTGAGGTTTCATCGGTGGTGGCATTC
CTATGCTTCCCAGCTGCTTCATATGTCACCGGGCAGGTTATTTGTGTTGA
CGGTGGATACTCTATCACTGGGTTTTAGCGCCACAGGCACCGAAAATTAT
CTTTGGAACGTCTTCACTGTCTTGTGTGCCATTCTAATAAGCTCTTTTTA
ATAAAGAAGATTCTGTGTTACTTTTGAAGTGTTTACATTGTCAATTGTCC
TGAATTTTGCACCNTTCCATCTTTGATAAATATAAATTTCCAAATTAAAG
AAAAAAAAAAAAAA
back to top