EY756189

Overview
NameEY756189
Unique NameEY756189
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length514
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6651 contig Csv1_Contig6651:569..1082. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756189 vs. ExPASy Swiss-Prot
Match: VSPB_SOYBN (Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.555e-29
Identity = 68/125 (54.40%), Postives = 82/125 (65.60%), Query Frame = 3
Query:   18 YNPTLFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAG-NRTFKLPDPMYYI 389
            +N TL++EWVN G A                G KIVFL+GR  D+  VTEANLK AGF TWE+LILK        A+ YKS+ R+ L  +GYRI+G IGDQWSDLLG + G +RTFKLP+PMYYI
Sbjct:  129 FNETLYDEWVNKGDAPALPETLKNYNKLLSLGFKIVFLSGRYLDKMAVTEANLKKAGFHTWEQLILKDPHLITPNALSYKSAMRENLLRQGYRIVGIIGDQWSDLLGDHRGESRTFKLPNPMYYI 253          
BLAST of EY756189 vs. ExPASy Swiss-Prot
Match: VSPA_SOYBN (Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 4.643e-29
Identity = 67/126 (53.17%), Postives = 84/126 (66.67%), Query Frame = 3
Query:   18 YNPTLFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKG-SSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAG-NRTFKLPDPMYYI 389
            +N TL++EWVN G A                G KI+FL+GR  D++ VTEANLK AG+ TWEKLILK     S   AV YK++ R+KL  +GY I+G IGDQWSDLLG + G +RTFKLP+P+YYI
Sbjct:  128 FNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQGYNIVGIIGDQWSDLLGGHRGESRTFKLPNPLYYI 253          
BLAST of EY756189 vs. ExPASy Swiss-Prot
Match: PPA1_SOLLC (Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 4.345e-27
Identity = 58/119 (48.74%), Postives = 73/119 (61.34%), Query Frame = 3
Query:   33 FNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI 389
            F++WV  G A                G K+  LTGR E  R+VT  NL +AGF  W KLIL+GS   G+TA  YKS  R  +  +G+RI+GN GDQWSDLLG++   R+FKLP+PMYYI
Sbjct:  136 FDKWVENGTAPALGSSLKLYQEVLKLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAMVEEGFRIVGNSGDQWSDLLGSSMSYRSFKLPNPMYYI 254          
BLAST of EY756189 vs. ExPASy Swiss-Prot
Match: S25K_SOYBN (Stem 31 kDa glycoprotein (Fragment) OS=Glycine max GN=VSP25 PE=2 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 9.680e-27
Identity = 64/122 (52.46%), Postives = 80/122 (65.57%), Query Frame = 3
Query:   18 YNPTLFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKG-SSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAG-NRTFKLPDP 377
            +N TL++EWVN G A                G KI+FL+GR  D++ VTEANLK AG+ TWEKLILK     S   AV YK++ R+KL  +GY I+G IGDQWSDLLG + G +RTFKLP+P
Sbjct:  125 FNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQGYNIVGIIGDQWSDLLGGHRGESRTFKLPNP 246          
BLAST of EY756189 vs. ExPASy Swiss-Prot
Match: VSP2_ARATH (Vegetative storage protein 2 OS=Arabidopsis thaliana GN=VSP2 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.549e-16
Identity = 47/93 (50.54%), Postives = 61/93 (65.59%), Query Frame = 3
Query:  111 GIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI 389
            GI+ + L+ R +  +NVT  NL+ AG   W+ LILK +  S    VVYKS  RK L  KGY I+GNIGDQW+DL+    G R FKLP+P+YY+
Sbjct:  173 GIEPIILSDRWKLWKNVTLDNLEAAGVTYWKHLILKPNG-SNLRQVVYKSKVRKSLVKKGYNIVGNIGDQWADLVEDTPG-RVFKLPNPLYYV 263          
BLAST of EY756189 vs. ExPASy Swiss-Prot
Match: VSP1_ARATH (Vegetative storage protein 1 OS=Arabidopsis thaliana GN=VSP1 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 7.688e-16
Identity = 45/93 (48.39%), Postives = 58/93 (62.37%), Query Frame = 3
Query:  111 GIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI 389
            GI+ + ++ R +    VT  NLK  G   W+ LILK +  S  T VVYKS  R  L  KGY I+GNIGDQW+DL+    G R FKLP+P+YY+
Sbjct:  178 GIEPIIISDRWKKLSEVTVENLKAVGVTKWKHLILKPNG-SKLTQVVYKSKVRNSLVKKGYNIVGNIGDQWADLVEDTPG-RVFKLPNPLYYV 268          
The following BLAST results are available for this feature:
BLAST of EY756189 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
VSPB_SOYBN3.555e-2954.40Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE... [more]
VSPA_SOYBN4.643e-2953.17Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE... [more]
PPA1_SOLLC4.345e-2748.74Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1... [more]
S25K_SOYBN9.680e-2752.46Stem 31 kDa glycoprotein (Fragment) OS=Glycine max... [more]
VSP2_ARATH1.549e-1650.54Vegetative storage protein 2 OS=Arabidopsis thalia... [more]
VSP1_ARATH7.688e-1648.39Vegetative storage protein 1 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-F10-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756189 ID=EY756189|Name=EY756189|organism=Citrus sinensis|type=EST|length=514bp
CCACGCGTCCGAAGCCATACAACCCTACTTTGTTTAATGAATGGGTGAAC
ACCGGAAAAGCACCACCGCTGCCAGAGAGCCTTAAGCTTTACAAAAAATT
ATTATTGCTTGGAATTAAGATTGTATTCCTCACGGGAAGACCAGAAGATC
AGAGAAATGTTACAGAAGCTAATTTAAAGCATGCTGGATTCGACACCTGG
GAGAAGCTCATCCTCAAGGGATCATCTCACTCAGGAGAAACAGCAGTGGT
GTACAAATCAAGTGAAAGAAAGAAGCTTGAGATGAAAGGGTACAGAATTA
TTGGAAACATAGGTGATCAATGGAGCGATCTCCTGGGCACCAACGCCGGC
AATCGGACGTTCAAGCTGCCTGACCCAATGTATTACATTGGCTAATTAAT
AAATAATGTTTACTTGGGATTTTGAATAAATAATCGAAGGGCCTTCATTT
GTGCACCAAAANGNANNTATAAAAGATNNAAAAAAAACTTACATGTGCAT
GAAAAANTNTAAAA
back to top