EY756187

Overview
NameEY756187
Unique NameEY756187
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length490
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13311 contig Csv1_Contig13311:1..490. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756187 vs. ExPASy Swiss-Prot
Match: QUA1_ARATH (Glycosyltransferase QUASIMODO1 OS=Arabidopsis thaliana GN=QUA1 PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 9.935e-55
Identity = 93/100 (93.00%), Postives = 99/100 (99.00%), Query Frame = 2
Query:    2 TEEYHYWQNLNENRTLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIQNAAVVHFNGNMKPWLDIAMNQFKPLWTKYVDYDLDFIQACNFG 301
            TEEYHYWQNLNENR LWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISM+EI+NAAVVHFNGNMKPWLDIAMNQF+PLWTK+VDYDL+F+QACNFG
Sbjct:  459 TEEYHYWQNLNENRALWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAMNQFRPLWTKHVDYDLEFVQACNFG 558          
BLAST of EY756187 vs. ExPASy Swiss-Prot
Match: GLTR_ARATH (Uncharacterized glycosyltransferase At3g02350 OS=Arabidopsis thaliana GN=At3g02350 PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 3.095e-48
Identity = 80/100 (80.00%), Postives = 93/100 (93.00%), Query Frame = 2
Query:    2 TEEYHYWQNLNENRTLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIQNAAVVHFNGNMKPWLDIAMNQFKPLWTKYVDYDLDFIQACNFG 301
            T++YHYWQNLNE+RTLWKLGTLPPGLITFYS TK LDKSWHVLGLGYNP +SM+EI+NA V+H+NGNMKPWLDIAMNQ+K LWTKYVD +++F+Q CNFG
Sbjct:  461 TDQYHYWQNLNEDRTLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAGVIHYNGNMKPWLDIAMNQYKSLWTKYVDNEMEFVQMCNFG 560          
The following BLAST results are available for this feature:
BLAST of EY756187 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
QUA1_ARATH9.935e-5593.00Glycosyltransferase QUASIMODO1 OS=Arabidopsis thal... [more]
GLTR_ARATH3.095e-4880.00Uncharacterized glycosyltransferase At3g02350 OS=A... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-F08-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756187 ID=EY756187|Name=EY756187|organism=Citrus sinensis|type=EST|length=490bp
CACAGAAGAGTATCATTACTGGCAGAATTTGAATGAGAATAGGACATTGT
GGAAATTGGGAACACTTCCTCCAGGTTTGATCACATTTTACTCGACTACA
AAACCACTAGACAAATCATGGCATGTATTGGGACTTGGATATAATCCGAG
CATTAGTATGGAAGAGATACAAAATGCTGCAGTTGTGCACTTCAATGGGA
ACATGAAACCTTGGCTTGATATTGCCATGAACCAATTCAAGCCGCTTTGG
ACCAAGTATGTTGATTACGATCTGGATTTCATTCAAGCGTGTAATTTTGG
GGCCTGAATTAATTTTCTTAGCAAAATGTCATAGTGAAGCAGTAAGTTAT
AATTAAGTCATCATCTCACTTTAGGATTTTATTTCAATTTGTCTATACAA
GTCCTCCGATTGCAATTAAATTGATTTGGCAAATGTAACAGTATTCAAGA
ACATCAATGAATTTTGAATTTCAAAAAAAAAAAAAAAAAA
back to top