EY756186

Overview
NameEY756186
Unique NameEY756186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length825
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756186 vs. ExPASy Swiss-Prot
Match: RS4_PRUAR (40S ribosomal protein S4 OS=Prunus armeniaca GN=RPS4 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.730e-26
Identity = 40/85 (47.06%), Postives = 51/85 (60.00%), Query Frame = 2
Query:  275 VTMDTGXXXXXXXXIIMISEYHLGSYETIHIQDTLGHELATLLGHVFTIRMGTNS*ISPPEGIAITLSFIEESLKRQSLKTSIAT 529
            V M TG        +I   E H GS+ETIH+QD  GHE AT LG+VFTI  GT   +S P+G  I L+ +EE+ KRQ+   + AT
Sbjct:  176 VVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTILEEAKKRQAAAQTAAT 260          

HSP 2 Score: 63.929 bits (154), Expect = 6.730e-26
Identity = 37/82 (45.12%), Postives = 45/82 (54.88%), Query Frame = 3
Query:   12 PQINANSLLLYDTNGRIHLTSFKYDEAIFKLCDVRSVQFWEERNPLPCTDDGRTILYAYXXXXXXXXXXXXXQTNLITNLIK 257
            P+ N N  LLYDT GR  L S + +E+ FKLC VRSVQF ++  P   T DGRTI Y               +TN IT+ IK
Sbjct:   89 PKTNENFRLLYDTKGRFRLHSIRDEESKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIK 170          
BLAST of EY756186 vs. ExPASy Swiss-Prot
Match: RS41_ARATH (40S ribosomal protein S4-1 OS=Arabidopsis thaliana GN=RPS4A PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.561e-24
Identity = 39/78 (50.00%), Postives = 48/78 (61.54%), Query Frame = 2
Query:  275 VTMDTGXXXXXXXXIIMISEYHLGSYETIHIQDTLGHELATLLGHVFTIRMGTNS*ISPPEGIAITLSFIEESLKRQS 508
            V M TG        +I   E H GS+ETIHIQD+ GHE AT LG+V+TI  GT   +S P+G  I L+ IEE+ KR S
Sbjct:  180 VVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKRLS 257          

HSP 2 Score: 61.2326 bits (147), Expect = 4.561e-24
Identity = 36/82 (43.90%), Postives = 42/82 (51.22%), Query Frame = 3
Query:   12 PQINANSLLLYDTNGRIHLTSFKYDEAIFKLCDVRSVQFWEERNPLPCTDDGRTILYAYXXXXXXXXXXXXXQTNLITNLIK 257
            P+ N N  LLYDT GR  L S K +EA FKLC VRS+QF ++  P   T DGRTI Y               + N I   IK
Sbjct:   93 PKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIK 174          
BLAST of EY756186 vs. ExPASy Swiss-Prot
Match: RS43_ARATH (40S ribosomal protein S4-3 OS=Arabidopsis thaliana GN=RPS4D PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 5.936e-24
Identity = 38/76 (50.00%), Postives = 47/76 (61.84%), Query Frame = 2
Query:  275 VTMDTGXXXXXXXXIIMISEYHLGSYETIHIQDTLGHELATLLGHVFTIRMGTNS*ISPPEGIAITLSFIEESLKR 502
            V M TG        +I   E H GS+ETIHIQD+ GHE AT LG+V+TI  GT   +S P+G  I L+ IEE+ KR
Sbjct:  180 VVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKR 255          

HSP 2 Score: 61.6178 bits (148), Expect = 5.936e-24
Identity = 36/82 (43.90%), Postives = 42/82 (51.22%), Query Frame = 3
Query:   12 PQINANSLLLYDTNGRIHLTSFKYDEAIFKLCDVRSVQFWEERNPLPCTDDGRTILYAYXXXXXXXXXXXXXQTNLITNLIK 257
            P+ N N  LLYDT GR  L S K +EA FKLC VRS+QF ++  P   T DGRTI Y               + N I   IK
Sbjct:   93 PKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIK 174          
BLAST of EY756186 vs. ExPASy Swiss-Prot
Match: RS42_ARATH (40S ribosomal protein S4-2 OS=Arabidopsis thaliana GN=RPS4B PE=2 SV=4)

HSP 1 Score: 70.8626 bits (172), Expect = 7.725e-24
Identity = 38/76 (50.00%), Postives = 47/76 (61.84%), Query Frame = 2
Query:  275 VTMDTGXXXXXXXXIIMISEYHLGSYETIHIQDTLGHELATLLGHVFTIRMGTNS*ISPPEGIAITLSFIEESLKR 502
            V M TG        +I   E H GS+ETIHIQD+ GHE AT LG+V+TI  GT   +S P+G  I L+ IEE+ KR
Sbjct:  180 VVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKR 255          

HSP 2 Score: 61.2326 bits (147), Expect = 7.725e-24
Identity = 36/82 (43.90%), Postives = 42/82 (51.22%), Query Frame = 3
Query:   12 PQINANSLLLYDTNGRIHLTSFKYDEAIFKLCDVRSVQFWEERNPLPCTDDGRTILYAYXXXXXXXXXXXXXQTNLITNLIK 257
            P+ N N  LLYDT GR  L S K +EA FKLC VRS+QF ++  P   T DGRTI Y               + N I   IK
Sbjct:   93 PKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIK 174          
BLAST of EY756186 vs. ExPASy Swiss-Prot
Match: RS4_ORYSJ (40S ribosomal protein S4 OS=Oryza sativa subsp. japonica GN=RPS4 PE=2 SV=3)

HSP 1 Score: 70.4774 bits (171), Expect = 1.308e-23
Identity = 38/84 (45.24%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  275 VTMDTGXXXXXXXXIIMISEYHLGSYETIHIQDTLGHELATLLGHVFTIRMGTNS*ISPPEGIAITLSFIEESLKRQSLKTSIA 526
            V M TG        +I   E H GS+ETIH++D LGH+ AT LG+VFTI  G    +S P+G  I LS IEE  KR +   + A
Sbjct:  180 VVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHQFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKRDAAAQAAA 263          

HSP 2 Score: 60.8474 bits (146), Expect = 1.308e-23
Identity = 36/82 (43.90%), Postives = 43/82 (52.44%), Query Frame = 3
Query:   12 PQINANSLLLYDTNGRIHLTSFKYDEAIFKLCDVRSVQFWEERNPLPCTDDGRTILYAYXXXXXXXXXXXXXQTNLITNLIK 257
            P+   N  LLYDT GR  L S K ++A FKLC VRSVQF ++  P   T DGRTI Y               +TN I + IK
Sbjct:   93 PKTGENYRLLYDTKGRFRLQSVKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIK 174          
BLAST of EY756186 vs. ExPASy Swiss-Prot
Match: RS4_MAIZE (40S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.882e-23
Identity = 37/84 (44.05%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  275 VTMDTGXXXXXXXXIIMISEYHLGSYETIHIQDTLGHELATLLGHVFTIRMGTNS*ISPPEGIAITLSFIEESLKRQSLKTSIA 526
            V M TG        +I   E H GS+ETIH++D+LGH+ AT +G+VFTI  G    +S P+G  I LS IEE  KR +   + A
Sbjct:  180 VVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKRDAAAQAAA 263          

HSP 2 Score: 60.077 bits (144), Expect = 2.882e-23
Identity = 35/82 (42.68%), Postives = 43/82 (52.44%), Query Frame = 3
Query:   12 PQINANSLLLYDTNGRIHLTSFKYDEAIFKLCDVRSVQFWEERNPLPCTDDGRTILYAYXXXXXXXXXXXXXQTNLITNLIK 257
            P+ N N  LLYDT GR  L   + ++A FKLC VRSVQF ++  P   T DGRTI Y               +TN I + IK
Sbjct:   93 PKTNENYRLLYDTKGRFRLHPIRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIK 174          
BLAST of EY756186 vs. ExPASy Swiss-Prot
Match: RS4_SOLTU (40S ribosomal protein S4 OS=Solanum tuberosum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.750e-23
Identity = 36/82 (43.90%), Postives = 51/82 (62.20%), Query Frame = 2
Query:  275 VTMDTGXXXXXXXXIIMISEYHLGSYETIHIQDTLGHELATLLGHVFTIRMGTNS*ISPPEGIAITLSFIEESLKRQSLKTS 520
            V M TG        +I   E H GS+ET+HIQD+ GHE AT LG+VFT+  GT   +S P+G  I L+ IE++ KR + +++
Sbjct:  180 VVMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEDARKRLAAQSA 261          

HSP 2 Score: 60.4622 bits (145), Expect = 3.750e-23
Identity = 35/82 (42.68%), Postives = 44/82 (53.66%), Query Frame = 3
Query:   12 PQINANSLLLYDTNGRIHLTSFKYDEAIFKLCDVRSVQFWEERNPLPCTDDGRTILYAYXXXXXXXXXXXXXQTNLITNLIK 257
            P+ N N  LLYDT GR  L S + +E+ FKLC VRSVQF ++  P   T DGRTI Y               ++N I + IK
Sbjct:   93 PKTNENFRLLYDTKGRFRLHSLRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIK 174          
BLAST of EY756186 vs. ExPASy Swiss-Prot
Match: RS4_GOSHI (40S ribosomal protein S4 OS=Gossypium hirsutum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.786e-22
Identity = 38/76 (50.00%), Postives = 45/76 (59.21%), Query Frame = 2
Query:  275 VTMDTGXXXXXXXXIIMISEYHLGSYETIHIQDTLGHELATLLGHVFTIRMGTNS*ISPPEGIAITLSFIEESLKR 502
            V M TG        +I   E H GS+ETIH+QD  GHE AT LG+VFTI  GT   +S P+   I LS IEE+ KR
Sbjct:  180 VVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKRKGIKLSIIEEARKR 255          

HSP 2 Score: 56.225 bits (134), Expect = 6.786e-22
Identity = 34/82 (41.46%), Postives = 42/82 (51.22%), Query Frame = 3
Query:   12 PQINANSLLLYDTNGRIHLTSFKYDEAIFKLCDVRSVQFWEERNPLPCTDDGRTILYAYXXXXXXXXXXXXXQTNLITNLIK 257
            P+ N +  LLYDT GR  L +   DE  FKLC VRSVQF ++  P   T DGRTI Y               ++N I + IK
Sbjct:   93 PKTNEDFRLLYDTKGRFCLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIK 174          
BLAST of EY756186 vs. ExPASy Swiss-Prot
Match: RS4B_SCHPO (40S ribosomal protein S4-B OS=Schizosaccharomyces pombe GN=rps4b PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 7.993e-15
Identity = 33/78 (42.31%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  281 MDTGXXXXXXXXIIMISEYHLGSYETIHIQDTLGHELATLLGHVFTIRMGTNS*ISPPEGIAITLSFIEESLKRQSLK 514
            M TG         I+  E+HLGS+E IH++D L  E AT L +VF I     S IS P+G  + LS  EE  +R++LK
Sbjct:  182 MVTGGRNMGRVGTIVHREHHLGSFEIIHVKDALDREFATRLSNVFVIGEAGKSWISLPKGKGVKLSITEERDRRRALK 259          

HSP 2 Score: 43.5134 bits (101), Expect = 7.993e-15
Identity = 26/74 (35.14%), Postives = 34/74 (45.95%), Query Frame = 3
Query:   36 LLYDTNGRIHLTSFKYDEAIFKLCDVRSVQFWEERNPLPCTDDGRTILYAYXXXXXXXXXXXXXQTNLITNLIK 257
            L+YD  GR  +     +EA +KLC V+ VQ   +  P   T DGRTI Y               +TN I + IK
Sbjct:  101 LVYDIKGRFTVHRITAEEAKYKLCKVKRVQLGAKGVPFLVTHDGRTIRYPDPLIKVNDTIKLNLETNKIESFIK 174          
BLAST of EY756186 vs. ExPASy Swiss-Prot
Match: RS4C_SCHPO (40S ribosomal protein S4-C OS=Schizosaccharomyces pombe GN=rps4c PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.350e-14
Identity = 33/78 (42.31%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  281 MDTGXXXXXXXXIIMISEYHLGSYETIHIQDTLGHELATLLGHVFTIRMGTNS*ISPPEGIAITLSFIEESLKRQSLK 514
            M TG         I+  E+HLGS+E IH++D L  E AT L +VF I     S IS P+G  + LS  EE  +R++LK
Sbjct:  182 MVTGGRNMGRVGTIVHREHHLGSFEIIHVKDALDREFATRLSNVFVIGETGKSWISLPKGKGVKLSITEERDRRRALK 259          

HSP 2 Score: 43.5134 bits (101), Expect = 1.350e-14
Identity = 26/74 (35.14%), Postives = 34/74 (45.95%), Query Frame = 3
Query:   36 LLYDTNGRIHLTSFKYDEAIFKLCDVRSVQFWEERNPLPCTDDGRTILYAYXXXXXXXXXXXXXQTNLITNLIK 257
            L+YD  GR  +     +EA +KLC V+ VQ   +  P   T DGRTI Y               +TN I + IK
Sbjct:  101 LVYDIKGRFTVHRITAEEAKYKLCKVKRVQLGAKGVPFLVTHDGRTIRYPDPLIKVNDTIKLNLETNKIESFIK 174          
The following BLAST results are available for this feature:
BLAST of EY756186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
RS4_PRUAR6.730e-2647.0640S ribosomal protein S4 OS=Prunus armeniaca GN=RP... [more]
RS41_ARATH4.561e-2450.0040S ribosomal protein S4-1 OS=Arabidopsis thaliana... [more]
RS43_ARATH5.936e-2450.0040S ribosomal protein S4-3 OS=Arabidopsis thaliana... [more]
RS42_ARATH7.725e-2450.0040S ribosomal protein S4-2 OS=Arabidopsis thaliana... [more]
RS4_ORYSJ1.308e-2345.2440S ribosomal protein S4 OS=Oryza sativa subsp. ja... [more]
RS4_MAIZE2.882e-2344.0540S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 ... [more]
RS4_SOLTU3.750e-2343.9040S ribosomal protein S4 OS=Solanum tuberosum GN=R... [more]
RS4_GOSHI6.786e-2250.0040S ribosomal protein S4 OS=Gossypium hirsutum GN=... [more]
RS4B_SCHPO7.993e-1542.3140S ribosomal protein S4-B OS=Schizosaccharomyces ... [more]
RS4C_SCHPO1.350e-1442.3140S ribosomal protein S4-C OS=Schizosaccharomyces ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-F07-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756186 ID=EY756186|Name=EY756186|organism=Citrus sinensis|type=EST|length=825bp
CCACGCGTCCGCCACAGATTAACGCCAACTCCCTTCTCCTTTACGACACC
AATGGACGGATCCACCTTACTTCATTCAAGTACGATGAAGCTATATTCAA
ACTCTGCGACGTACGATCAGTGCAATTCTGGGAAGAACGGAATCCCTTAC
CCTGCACTGATGACGGGAGGACTATTCTCTACGCATACCCACTCCTCCCG
GTCCTTGATACCATCCTGCTAGACCTGCAGACTAACCTCATCACCAATCT
CATCAAGGATCATGTGCGGAAATGGTTACCATGGATACTGGTAGGAGAAA
CCGACGACGTGTCCGAATCATTATGATCTCAGAATACCATCTCGGTAGCT
ATGAGACTATCCACATCCAGGATACTCTGGGCCATGAGCTGGCAACTCTC
CTTGGACATGTGTTCACCATTAGGATGGGTACAAACTCATGAATATCTCC
TCCCGAGGGCATAGCAATTACACTATCCTTCATTGAGGAGAGCTTGAAGA
GACAATCCCTGAAGACTTCTATAGCCACCCTCTGATGATAAACTTCATGG
TCTATCCTATATGTGATTAGAAAGATGACTACATGAAATTTGTGCAATTT
GAACACTCACTGATTGCCTGCCCTACTTACGCGCCAGGAGAACATAATAT
CATAAACGCCTTCAGGCTCTATGATCGGATACATACTGAGTACGTTGAGA
GACAGGAGACTCTTCTATGTTAGCAGCCATATTGATGGAATCTGGGGCGG
CCTCGTCAGATGATCCTACTTTACCACCATTGATAGACATTTGCAGATGC
TCTATAGGTCACCGTGGCTCAATCA
back to top