EY756185

Overview
NameEY756185
Unique NameEY756185
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length423
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6114 contig Csv1_Contig6114:126..544. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756185 vs. ExPASy Swiss-Prot
Match: PMGI_TOBAC (2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.257e-18
Identity = 42/51 (82.35%), Postives = 45/51 (88.24%), Query Frame = 3
Query:   12 KPVPIAIGGPGLPDNVKFRADLPNGGLANVAATFINLHGYEAPSDYEPSLI 164
            +PVPIAIGGPGL   V+FR DLP GGLANVAATF+NLHG EAPSDYEPSLI
Sbjct:  504 EPVPIAIGGPGLAPGVRFRQDLPTGGLANVAATFMNLHGSEAPSDYEPSLI 554          
BLAST of EY756185 vs. ExPASy Swiss-Prot
Match: PMGI_RICCO (2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ricinus communis PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 2.377e-17
Identity = 39/51 (76.47%), Postives = 46/51 (90.20%), Query Frame = 3
Query:   12 KPVPIAIGGPGLPDNVKFRADLPNGGLANVAATFINLHGYEAPSDYEPSLI 164
            +PVPIAIGGPGL   V+FR+D+P GGLANVAAT +NLHG+EAPSDYEP+LI
Sbjct:  501 QPVPIAIGGPGLTPGVRFRSDIPTGGLANVAATVMNLHGFEAPSDYEPTLI 551          
BLAST of EY756185 vs. ExPASy Swiss-Prot
Match: PMGI_MESCR (2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mesembryanthemum crystallinum GN=PGM1 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.296e-17
Identity = 39/51 (76.47%), Postives = 45/51 (88.24%), Query Frame = 3
Query:   12 KPVPIAIGGPGLPDNVKFRADLPNGGLANVAATFINLHGYEAPSDYEPSLI 164
            +PVPIAIGGPGL   V+FR D+P GGLANVAAT +NLHG+EAPSDYEP+LI
Sbjct:  504 EPVPIAIGGPGLTPGVRFRNDIPTGGLANVAATVMNLHGFEAPSDYEPTLI 554          
BLAST of EY756185 vs. ExPASy Swiss-Prot
Match: PMGI_PRUDU (2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Fragment) OS=Prunus dulcis PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.629e-16
Identity = 38/51 (74.51%), Postives = 45/51 (88.24%), Query Frame = 3
Query:   12 KPVPIAIGGPGLPDNVKFRADLPNGGLANVAATFINLHGYEAPSDYEPSLI 164
            +PVPIAIGGPGL   V+FR D+PNGGLANVAAT +NLHG+EAP+DYE +LI
Sbjct:  433 QPVPIAIGGPGLAPGVQFRKDVPNGGLANVAATVMNLHGFEAPADYETTLI 483          
BLAST of EY756185 vs. ExPASy Swiss-Prot
Match: PMG1_ARATH (2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 OS=Arabidopsis thaliana GN=PGM1 PE=2 SV=3)

HSP 1 Score: 80.4925 bits (197), Expect = 2.906e-15
Identity = 38/51 (74.51%), Postives = 42/51 (82.35%), Query Frame = 3
Query:   12 KPVPIAIGGPGLPDNVKFRADLPNGGLANVAATFINLHGYEAPSDYEPSLI 164
            KPVPIAIGGPGL   V+FR DL   GLANVAAT +NLHG+ APSDYEP+LI
Sbjct:  503 KPVPIAIGGPGLAQGVRFRKDLETPGLANVAATVMNLHGFVAPSDYEPTLI 553          
BLAST of EY756185 vs. ExPASy Swiss-Prot
Match: PMG2_ARATH (Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 OS=Arabidopsis thaliana GN=At3g08590 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.213e-14
Identity = 37/51 (72.55%), Postives = 41/51 (80.39%), Query Frame = 3
Query:   12 KPVPIAIGGPGLPDNVKFRADLPNGGLANVAATFINLHGYEAPSDYEPSLI 164
            KPVPIAIGGPGL   V+FR D+   GLANVAAT +NLHG+ APSDYE SLI
Sbjct:  505 KPVPIAIGGPGLSAGVRFRQDIETPGLANVAATVMNLHGFVAPSDYETSLI 555          
BLAST of EY756185 vs. ExPASy Swiss-Prot
Match: PMGI_MAIZE (2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Zea mays PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.481e-14
Identity = 35/51 (68.63%), Postives = 42/51 (82.35%), Query Frame = 3
Query:   12 KPVPIAIGGPGLPDNVKFRADLPNGGLANVAATFINLHGYEAPSDYEPSLI 164
            +PVP+AIGGPGL   VKFR D+   GLANVAAT +NLHG+EAP+DYE +LI
Sbjct:  504 QPVPVAIGGPGLHPGVKFRNDIQTPGLANVAATVMNLHGFEAPADYEQTLI 554          
The following BLAST results are available for this feature:
BLAST of EY756185 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
PMGI_TOBAC6.257e-1882.352,3-bisphosphoglycerate-independent phosphoglycera... [more]
PMGI_RICCO2.377e-1776.472,3-bisphosphoglycerate-independent phosphoglycera... [more]
PMGI_MESCR5.296e-1776.472,3-bisphosphoglycerate-independent phosphoglycera... [more]
PMGI_PRUDU2.629e-1674.512,3-bisphosphoglycerate-independent phosphoglycera... [more]
PMG1_ARATH2.906e-1574.512,3-bisphosphoglycerate-independent phosphoglycera... [more]
PMG2_ARATH3.213e-1472.55Probable 2,3-bisphosphoglycerate-independent phosp... [more]
PMGI_MAIZE5.481e-1468.632,3-bisphosphoglycerate-independent phosphoglycera... [more]
back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-F06-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756185 ID=EY756185|Name=EY756185|organism=Citrus sinensis|type=EST|length=423bp
CCACGCGTCCGAAACCCGTTCCCATTGCAATCGGAGGTCCTGGACTGCCA
GATAATGTCAAGTTCCGCGCAGATCTCCCTAATGGTGGGCTCGCCAATGT
AGCAGCAACTTTTATCAATCTCCATGGATATGAAGCACCTAGTGACTACG
AGCCAAGTCTTATTGAAGTAACTGACGACTGAGAAGTAACTGACGACTGG
GCGAACAATGGATCGTCGCCTAGATTTTATAACTCCGGAGGAATTCCGTT
AAAACGTAAAACAATAAATTGAATTTTGGGGTCTTGAATTCATTTTGATA
CGCGTGCTGTTTTTCAGCTTACATTTCGATTGCTGTCTGTTGGAGGCAGA
CAGAACAATATAGCTCAAAATTTATTTTTGTTNNNNNAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAANAA
back to top