EY756184

Overview
NameEY756184
Unique NameEY756184
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length775
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2352 contig Csv1_Contig2352:152..924. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756184 vs. ExPASy Swiss-Prot
Match: PROF_PRUPE (Profilin OS=Prunus persica PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 7.467e-67
Identity = 116/129 (89.92%), Postives = 126/129 (97.67%), Query Frame = 3
Query:   75 WQAYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 461
            WQAYVDDHL+CEIEGNHLSAAAIIGHDGSVWAQS  FPQLKPEE+TGI+NDFNEPG+LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVT+KK++ AL+IGIYDEPMTPGQCNMIVERLGDYL++QGL
Sbjct:    3 WQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVERLGDYLVEQGL 131          
BLAST of EY756184 vs. ExPASy Swiss-Prot
Match: PROF2_MALDO (Profilin-2 OS=Malus domestica PE=1 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.706e-66
Identity = 115/129 (89.15%), Postives = 125/129 (96.90%), Query Frame = 3
Query:   75 WQAYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 461
            WQAYVDDHL+CEIEGNHLSAAAIIGH+GSVWAQS  FPQLKPEE+TGIMNDFNEPG+LAPTGLYLGGTKYMVIQGEPG VIRGKKGPGGVT+KK++ AL+IGIYDEPMTPGQCNM+VERLGDYLI+QGL
Sbjct:    3 WQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVERLGDYLIEQGL 131          
BLAST of EY756184 vs. ExPASy Swiss-Prot
Match: PROF2_AMBAR (Profilin-2 OS=Ambrosia artemisiifolia GN=A0418 PE=1 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 6.321e-66
Identity = 117/128 (91.41%), Postives = 123/128 (96.09%), Query Frame = 3
Query:   75 WQAYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 458
            WQAYVDDHL+CEIEGNHLSAAAIIGHDG VWAQS  FPQ+KPEEITGIMNDFNEPG+LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKT+ ALIIGIYDEPM PGQCNMIVERLGDYL++QG
Sbjct:    3 WQAYVDDHLMCEIEGNHLSAAAIIGHDGVVWAQSATFPQVKPEEITGIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTMALIIGIYDEPMAPGQCNMIVERLGDYLLEQG 130          
BLAST of EY756184 vs. ExPASy Swiss-Prot
Match: PROF2_HEVBR (Profilin-2 OS=Hevea brasiliensis GN=PRO2 PE=1 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.408e-65
Identity = 117/128 (91.41%), Postives = 123/128 (96.09%), Query Frame = 3
Query:   75 WQAYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 458
            WQAYVDDHL+CEIEGNHLSAAAIIG DGSVWAQS NFPQ K EEITGIM+DF+EPGTLAPTGLY+GGTKYMVIQGEPGAVIRGKKGPGGVT+KKT+ ALIIGIYDEPMTPGQCNMIVERLGDYLIDQG
Sbjct:    3 WQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 130          
BLAST of EY756184 vs. ExPASy Swiss-Prot
Match: PROF1_AMBAR (Profilin-1 OS=Ambrosia artemisiifolia GN=D106 PE=1 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 4.097e-65
Identity = 115/128 (89.84%), Postives = 123/128 (96.09%), Query Frame = 3
Query:   75 WQAYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 458
            WQAYVDDHL+CEIEGNHLSAAAIIGHDG VWAQS  FPQ+KPEEITGIMNDFNEPG+LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKT+ +LIIGIYDEPMTPGQCNM+VER GDYL++QG
Sbjct:    3 WQAYVDDHLMCEIEGNHLSAAAIIGHDGVVWAQSATFPQVKPEEITGIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTMSLIIGIYDEPMTPGQCNMLVERPGDYLLEQG 130          
BLAST of EY756184 vs. ExPASy Swiss-Prot
Match: PROF_FRAAN (Profilin OS=Fragaria ananassa PE=1 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 5.351e-65
Identity = 114/129 (88.37%), Postives = 123/129 (95.35%), Query Frame = 3
Query:   75 WQAYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 461
            WQ YVDDHL+CEIEGNHLSAAAIIG DGSVWAQS  FPQLKPEE+TGI+ DF+EPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVT+KKT+ AL+IGIYDEPMTPGQCNMIVERLGDYL++QGL
Sbjct:    3 WQTYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSATFPQLKPEEVTGIVRDFDEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTTLALLIGIYDEPMTPGQCNMIVERLGDYLVEQGL 131          
BLAST of EY756184 vs. ExPASy Swiss-Prot
Match: PROF1_RICCO (Profilin-1 OS=Ricinus communis GN=PRO1 PE=2 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 9.127e-65
Identity = 115/129 (89.15%), Postives = 121/129 (93.80%), Query Frame = 3
Query:   75 WQAYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 461
            WQ YVDDHL+CEIEGNHL++AAIIG DGSVWAQS  FPQ KPEEIT IMNDFNEPG+LAPTGLYL GTKYMVIQGEPGAVIRGKKGPGGVT+KKT+ ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
Sbjct:    3 WQTYVDDHLMCEIEGNHLTSAAIIGQDGSVWAQSSTFPQFKPEEITAIMNDFNEPGSLAPTGLYLSGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 131          
BLAST of EY756184 vs. ExPASy Swiss-Prot
Match: PROF1_PHAVU (Profilin-1 OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.192e-64
Identity = 113/129 (87.60%), Postives = 123/129 (95.35%), Query Frame = 3
Query:   75 WQAYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 461
            WQ YVDDHLLCEIEGNHL+ AAI+G DGSVWA+S +FPQ KPEEITGIMNDFNEPGTLAPTGLY+GGTKYMVIQGEPG+VIRGKKGPGGVT+KKT+ AL+IGIYDEPMTPGQCNMIVERLGDYLI+QGL
Sbjct:    3 WQTYVDDHLLCEIEGNHLTHAAILGQDGSVWAKSASFPQFKPEEITGIMNDFNEPGTLAPTGLYIGGTKYMVIQGEPGSVIRGKKGPGGVTVKKTNLALVIGIYDEPMTPGQCNMIVERLGDYLIEQGL 131          
BLAST of EY756184 vs. ExPASy Swiss-Prot
Match: PROF1_SOYBN (Profilin-1 OS=Glycine max GN=PRO1 PE=1 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.557e-64
Identity = 115/128 (89.84%), Postives = 121/128 (94.53%), Query Frame = 3
Query:   75 WQAYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 458
            WQAYVDDHLLC+IEGNHL+ AAIIG DGSVWAQS +FPQ KPEEIT IMNDFNEPG+LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVT+KKT AALIIGIYDEPMTPGQCNM+VER GDYLIDQG
Sbjct:    3 WQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERPGDYLIDQG 130          
BLAST of EY756184 vs. ExPASy Swiss-Prot
Match: PROF2_SOYBN (Profilin-2 OS=Glycine max GN=PRO2 PE=1 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.656e-64
Identity = 115/128 (89.84%), Postives = 120/128 (93.75%), Query Frame = 3
Query:   75 WQAYVDDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 458
            WQAYVDDHLLC IEGNHL+ AAIIG DGSVW QS +FPQ KPEEIT IMNDFNEPG+LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVT+KKT AALIIGIYDEPMTPGQCNM+VERLGDYLIDQG
Sbjct:    3 WQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERLGDYLIDQG 130          
The following BLAST results are available for this feature:
BLAST of EY756184 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
PROF_PRUPE7.467e-6789.92Profilin OS=Prunus persica PE=1 SV=1[more]
PROF2_MALDO3.706e-6689.15Profilin-2 OS=Malus domestica PE=1 SV=1[more]
PROF2_AMBAR6.321e-6691.41Profilin-2 OS=Ambrosia artemisiifolia GN=A0418 PE=... [more]
PROF2_HEVBR1.408e-6591.41Profilin-2 OS=Hevea brasiliensis GN=PRO2 PE=1 SV=1[more]
PROF1_AMBAR4.097e-6589.84Profilin-1 OS=Ambrosia artemisiifolia GN=D106 PE=1... [more]
PROF_FRAAN5.351e-6588.37Profilin OS=Fragaria ananassa PE=1 SV=1[more]
PROF1_RICCO9.127e-6589.15Profilin-1 OS=Ricinus communis GN=PRO1 PE=2 SV=1[more]
PROF1_PHAVU1.192e-6487.60Profilin-1 OS=Phaseolus vulgaris PE=1 SV=1[more]
PROF1_SOYBN1.557e-6489.84Profilin-1 OS=Glycine max GN=PRO1 PE=1 SV=1[more]
PROF2_SOYBN2.656e-6489.84Profilin-2 OS=Glycine max GN=PRO2 PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-F04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756184 ID=EY756184|Name=EY756184|organism=Citrus sinensis|type=EST|length=775bp
CCACGCGTCCGCTTCAGGAAAAAAAAAAATTCACAGAGAAATCAGAGGAA
TCATCAAAGCAGAAAAAGATGTCGTGGCAAGCTTACGTCGATGATCATCT
GTTGTGTGAAATTGAGGGTAACCATCTCTCAGCTGCCGCTATCATCGGCC
ACGACGGCAGCGTTTGGGCCCAGAGTGAAAACTTCCCTCAGTTAAAACCT
GAGGAAATAACTGGTATCATGAATGACTTTAATGAACCTGGAACACTAGC
ACCAACTGGACTGTATCTTGGTGGCACAAAATATATGGTGATCCAGGGTG
AGCCAGGTGCTGTCATCCGAGGGAAGAAGGGCCCTGGTGGTGTTACCATC
AAGAAGACCAGTGCGGCCTTAATCATTGGAATCTATGATGAGCCGATGAC
CCCTGGGCAGTGCAACATGATTGTTGAAAGGCTTGGTGATTATCTCATTG
ATCAGGGTCTTTAGGTGGTTTGCATGTCCGCTAATTTGTTTCATTTCTTG
GCTTCCCTAAAAAGCTCGCACTGTTGAACTTCGGTGTAATAATATTACAG
TATTCAAAGTTATGGGAACTGTGTGTGGAAAGGAAAGGTTTGGTGCATGT
GGAAGTTCTTGATATCAGCTATTTGTAGTATTGNTATGGTTGTCGAGGTA
CTTTACCATCACTATTACAGTGGATCCTAATGGATGTGTCAATTTTGAGT
GTAAAACTTGTGAGATTCTTGTTTCTCAATGATTTTGCGTTGGGTGTAAA
AAAAAAAAAAAAAAAAAAAAGGGGG
back to top