EY756181

Overview
NameEY756181
Unique NameEY756181
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length459
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756181 vs. ExPASy Swiss-Prot
Match: UGPI5_ARATH (Uncharacterized GPI-anchored protein At1g27950 OS=Arabidopsis thaliana GN=At1g27950 PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 5.148e-33
Identity = 69/121 (57.02%), Postives = 87/121 (71.90%), Query Frame = 2
Query:  125 ECSEYLQKTMACLDFARGKITTPSKECCSAVKGIKDDDPKCLCYIIKEANGGEGDIVKNLGVQVPKLLQLPSACQLKNASTSLCPKLLGLSPSSPDAAIFTNTS----------SSATPTT 457
            EC++  QK   CLDFA GK T PSK+CC AV+ IK+ DPKCLC++I++A  G G  +K+LGVQ  KL+QLP++CQL NAS + CPKLLG+SPSSPDAA+FTN +          S ATP T
Sbjct:   34 ECNQDFQKVTLCLDFATGKATIPSKKCCDAVEDIKERDPKCLCFVIQQAKTG-GQALKDLGVQEDKLIQLPTSCQLHNASITNCPKLLGISPSSPDAAVFTNNATTTPVAPAGKSPATPAT 153          
The following BLAST results are available for this feature:
BLAST of EY756181 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
UGPI5_ARATH5.148e-3357.02Uncharacterized GPI-anchored protein At1g27950 OS=... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-E12-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756181 ID=EY756181|Name=EY756181|organism=Citrus sinensis|type=EST|length=459bp
TTCGTCAACCCCGCGTCCGGGGCAAAAGTGACAAGATAATGGGAATGAAA
AAAGGGTTTCTATGTGGCATATTGTTTGGCTTTTTGNGCTAAAGAAAGTA
ACGGCTGATGACGCTACAAATAAGGAGTGTAGTGAGTATTTGCAGAAGAC
GATGGCCTGTTTGGATTTTGCAAGGGGGAAGATTACGACTCCGTCCAAAG
AATGTTGCAGCGCTGTGAAGGGTATAAAAGACGATGATCCAAAGTGTTTG
TGTTATATCATCAAGGAGGCTAATGGCGGTGAAGGCGATATTGTTAAGAA
CTTGGGCGTGCAGGTGCCTAAGCTGCTTCAGCTTCCATCCGCTTGCCAGT
TGAAAAATGCCAGCACCAGTCTCTGCCCAAAGCTTCTAGGGCTATCTCCT
AGCTCTCCAGATGCTGCAATATTCACAAATACTTCTTCATCGGCAACTCC
AACTACACC
back to top