EY756180

Overview
NameEY756180
Unique NameEY756180
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length456
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig906 contig Csv1_Contig906:700..1155. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756180 vs. ExPASy Swiss-Prot
Match: 6PGL4_ORYSJ (Probable 6-phosphogluconolactonase 4, chloroplastic OS=Oryza sativa subsp. japonica GN=Os09g0529100 PE=2 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 1.228e-26
Identity = 61/88 (69.32%), Postives = 70/88 (79.55%), Query Frame = 1
Query:    1 PRVRGELTWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQ-NSDLLPVQMALAEE-EFTWFLDKDATSKL 258
            P V     WVT+IKDSPKPPPERITFTFPVINSSAY+AMVV GAGK+ AVQ AL + Q +SDLLPV+MA+ ++ EFTWF DK A S L
Sbjct:  234 PLVNENKKWVTYIKDSPKPPPERITFTFPVINSSAYVAMVVTGAGKAGAVQKALSDKQTSSDLLPVEMAVLQDGEFTWFTDKPAVSML 321          
BLAST of EY756180 vs. ExPASy Swiss-Prot
Match: 6PGL4_ORYSI (Probable 6-phosphogluconolactonase 4, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_031067 PE=3 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 1.228e-26
Identity = 61/88 (69.32%), Postives = 70/88 (79.55%), Query Frame = 1
Query:    1 PRVRGELTWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQ-NSDLLPVQMALAEE-EFTWFLDKDATSKL 258
            P V     WVT+IKDSPKPPPERITFTFPVINSSAY+AMVV GAGK+ AVQ AL + Q +SDLLPV+MA+ ++ EFTWF DK A S L
Sbjct:  234 PLVNENKKWVTYIKDSPKPPPERITFTFPVINSSAYVAMVVTGAGKAGAVQKALSDKQTSSDLLPVEMAVLQDGEFTWFTDKPAVSML 321          
BLAST of EY756180 vs. ExPASy Swiss-Prot
Match: 6PGL3_ORYSJ (Probable 6-phosphogluconolactonase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0547100 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.835e-22
Identity = 54/88 (61.36%), Postives = 65/88 (73.86%), Query Frame = 1
Query:    1 PRVRGELTWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQ-NSDLLPVQMALAEE-EFTWFLDKDATSKL 258
            P V   L WV++IKDSPKPPPERITFTFP++NSSA+IA+VV GAGK+ AV  A  + Q +SDLLPV+M   +E   TWF DK A S L
Sbjct:  237 PVVNENLKWVSYIKDSPKPPPERITFTFPLVNSSAHIALVVTGAGKAGAVHKAFSDKQSSSDLLPVEMVSQQEGVLTWFTDKPAVSML 324          
BLAST of EY756180 vs. ExPASy Swiss-Prot
Match: 6PGL3_ORYSI (Probable 6-phosphogluconolactonase 3, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_30141 PE=3 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 1.835e-22
Identity = 54/88 (61.36%), Postives = 65/88 (73.86%), Query Frame = 1
Query:    1 PRVRGELTWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQ-NSDLLPVQMALAEE-EFTWFLDKDATSKL 258
            P V   L WV++IKDSPKPPPERITFTFP++NSSA+IA+VV GAGK+ AV  A  + Q +SDLLPV+M   +E   TWF DK A S L
Sbjct:  237 PVVNENLKWVSYIKDSPKPPPERITFTFPLVNSSAHIALVVTGAGKAGAVHKAFSDKQSSSDLLPVEMVSQQEGVLTWFTDKPAVSML 324          
BLAST of EY756180 vs. ExPASy Swiss-Prot
Match: 6PGL5_ARATH (Probable 6-phosphogluconolactonase 5, chloroplastic OS=Arabidopsis thaliana GN=EMB2024 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.827e-20
Identity = 47/78 (60.26%), Postives = 58/78 (74.36%), Query Frame = 1
Query:   25 WVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKDATSKL 258
            WV  I DSPKPP ERITFTFPVINSSA++A+VVCG+GK+ AV+ AL   +  ++ P     AE+E  WFLDK A+SKL
Sbjct:  250 WVVSISDSPKPPSERITFTFPVINSSAHVALVVCGSGKAEAVEAAL--KKTGNVPPAGSVSAEDELVWFLDKPASSKL 325          
BLAST of EY756180 vs. ExPASy Swiss-Prot
Match: 6PGL2_ORYSJ (Probable 6-phosphogluconolactonase 2 OS=Oryza sativa subsp. japonica GN=Os07g0604000 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 8.257e-15
Identity = 41/83 (49.40%), Postives = 53/83 (63.86%), Query Frame = 1
Query:   25 WVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNS----DLLPVQMAL-AEEEFTWFLDKDATSKL 258
            W+T+I DSP+PPPERITFT PVINS++ IA+V  G  KS AV  A+ +N +       LP +M    + +  WFLDK A S L
Sbjct:  184 WITYITDSPQPPPERITFTLPVINSASNIAIVTTGDDKSEAVHLAISDNADGPEAPSSLPARMVQPTDGKLVWFLDKSAASSL 266          
BLAST of EY756180 vs. ExPASy Swiss-Prot
Match: 6PGL2_ORYSI (Probable 6-phosphogluconolactonase 2 OS=Oryza sativa subsp. indica GN=OsI_025867 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 8.257e-15
Identity = 41/83 (49.40%), Postives = 53/83 (63.86%), Query Frame = 1
Query:   25 WVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNS----DLLPVQMAL-AEEEFTWFLDKDATSKL 258
            W+T+I DSP+PPPERITFT PVINS++ IA+V  G  KS AV  A+ +N +       LP +M    + +  WFLDK A S L
Sbjct:  184 WITYITDSPQPPPERITFTLPVINSASNIAIVTTGDDKSEAVHLAISDNADGPEAPSSLPARMVQPTDGKLVWFLDKSAASSL 266          
BLAST of EY756180 vs. ExPASy Swiss-Prot
Match: 6PGL3_ARATH (Probable 6-phosphogluconolactonase 3 OS=Arabidopsis thaliana GN=At5g24420 PE=2 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 5.352e-14
Identity = 38/86 (44.19%), Postives = 53/86 (61.63%), Query Frame = 1
Query:    1 PRVRGELTWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKDATSKL 258
            P++  +  WVT+I DSPKPPP+RITFT PVINS+ Y  M +C    + +V   + +N  S  LP     A+ E  W+LD+ A S+L
Sbjct:  169 PQINEKQKWVTYITDSPKPPPKRITFTLPVINSTLYNLMAICDKAPAKSVAEIMKHNNLS--LPSAHLSAQVENVWYLDQAAASEL 252          
BLAST of EY756180 vs. ExPASy Swiss-Prot
Match: 6PGL4_ARATH (Probable 6-phosphogluconolactonase 4 OS=Arabidopsis thaliana GN=At5g24410 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.469e-13
Identity = 37/85 (43.53%), Postives = 52/85 (61.18%), Query Frame = 1
Query:    4 RVRGELTWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKDATSKL 258
            +++ +   VT+I DSPKPPP+RITFT PVIN ++Y  M VC   ++ AV     +N +   LP     A+ E  WFLD+ A SK+
Sbjct:  176 QIKEKANLVTYITDSPKPPPKRITFTLPVINCASYNLMAVCDEAQADAVAKVFNHNFD---LPAAWLTADVEAIWFLDQAAASKI 257          
BLAST of EY756180 vs. ExPASy Swiss-Prot
Match: 6PGL2_ARATH (Probable 6-phosphogluconolactonase 2 OS=Arabidopsis thaliana GN=At3g49360 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 4.531e-13
Identity = 37/85 (43.53%), Postives = 52/85 (61.18%), Query Frame = 1
Query:    4 RVRGELTWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKDATSKL 258
            ++  ++ WVT I DSPKPP +RIT T PVIN ++Y  M VC   ++ +V  AL + ++   LP     A+ E  WFLD+ A SKL
Sbjct:  170 QINEKVKWVTSITDSPKPPSKRITLTLPVINCASYNVMAVCDKEQADSVAAALNHTKD---LPAGRLTADVEVVWFLDQAAASKL 251          
The following BLAST results are available for this feature:
BLAST of EY756180 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
6PGL4_ORYSJ1.228e-2669.32Probable 6-phosphogluconolactonase 4, chloroplasti... [more]
6PGL4_ORYSI1.228e-2669.32Probable 6-phosphogluconolactonase 4, chloroplasti... [more]
6PGL3_ORYSJ1.835e-2261.36Probable 6-phosphogluconolactonase 3, chloroplasti... [more]
6PGL3_ORYSI1.835e-2261.36Probable 6-phosphogluconolactonase 3, chloroplasti... [more]
6PGL5_ARATH3.827e-2060.26Probable 6-phosphogluconolactonase 5, chloroplasti... [more]
6PGL2_ORYSJ8.257e-1549.40Probable 6-phosphogluconolactonase 2 OS=Oryza sati... [more]
6PGL2_ORYSI8.257e-1549.40Probable 6-phosphogluconolactonase 2 OS=Oryza sati... [more]
6PGL3_ARATH5.352e-1444.19Probable 6-phosphogluconolactonase 3 OS=Arabidopsi... [more]
6PGL4_ARATH3.469e-1343.53Probable 6-phosphogluconolactonase 4 OS=Arabidopsi... [more]
6PGL2_ARATH4.531e-1343.53Probable 6-phosphogluconolactonase 2 OS=Arabidopsi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-E11-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756180 ID=EY756180|Name=EY756180|organism=Citrus sinensis|type=EST|length=456bp
CCACGCGTCCGAGGAGAATTGACATGGGTTACTTTCATTAAAGACTCGCC
AAAGCCACCTCCAGAGAGAATCACTTTCACCTTCCCTGTAATCAACTCAT
CTGCATATATTGCAATGGTGGTGTGTGGTGCTGGAAAATCAAGTGCAGTT
CAAACTGCATTGGGTAATAATCAAAACTCTGATTTGCTGCCAGTTCAAAT
GGCATTGGCTGAAGAAGAATTCACTTGGTTTCTTGACAAAGACGCGACTT
CAAAGCTGTAAGAGTCAGAACAATTTGCTGTATGCATGAATCCCTGTTAT
CTGCTATGATAATTGGTTTGATCTGTGTGGTTTGACTACTAGTACTGCTG
GATTTTGTTAGTAATGAGAACAGAGTGAACTTGTTAATGCAAGTGAAAAA
GATTTGAATAAATATAGTTTGATATTTTAATAAAAAAAAAAAAAAAAAAA
AAAAAA
back to top