EY756177

Overview
NameEY756177
Unique NameEY756177
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length901
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756177 vs. ExPASy Swiss-Prot
Match: Y3804_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.512e-104
Identity = 182/246 (73.98%), Postives = 218/246 (88.62%), Query Frame = 3
Query:   12 EDFYREVRVLGKARHPNLISLVGHYWTPQLKLLVSDYAPNGSLQAKLHERLPSTPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVM-SNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEYGEDNVVILSEHVRVLLEEGNVLDCVDPSMGD-YPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQVIKTPLPQRM 743
            EDF REVR+L KA+HPNL+S+ G++WTP L LLVS+Y PNG+LQ+KLHER PSTPPLSW  R+K+ILGTAKGLA+LHH+FRP  IH+NLKP+NILLD+  NP+ISDFGL+RLLT  D + M +NRFQ+ALGYVAPEL CQ+LRVNEKCD+YGFGVLILELVTGRRPVEYGED+ VILS+HVRV+LE+GNVL+C+DP M + Y EDEVLPVLKLALVCT  IPS+RP+MAE+VQILQVI +P+P R+
Sbjct:  767 EDFDREVRILAKAKHPNLVSIKGYFWTPDLHLLVSEYIPNGNLQSKLHEREPSTPPLSWDVRYKIILGTAKGLAYLHHTFRPTTIHFNLKPTNILLDEKNNPKISDFGLSRLLTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVILSDHVRVMLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQILQVINSPVPHRI 1012          
BLAST of EY756177 vs. ExPASy Swiss-Prot
Match: Y1124_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=1 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.340e-60
Identity = 115/245 (46.94%), Postives = 172/245 (70.20%), Query Frame = 3
Query:   12 EDFYREVRVLGKARHPNLISLVGHYWTPQLKLLVSDYAPNGSLQAKLHERL-PSTPP------LSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEY-GEDNVVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQVIK 722
            E+F +E+  LG  +HPNL S  G+Y++  ++L++S++ PNGSL   LH R+ P T        L+W  RF++ LGTAK L+ LH+  +P I+H N+K +NILLD+ Y  ++SD+GL + L  +D   ++ +F +A+GY+APEL  QSLR +EKCD+Y +GV++LELVTGR+PVE   E+ V+IL ++VR LLE G+  DC D  + ++ E+E++ V+KL L+CT   P  RPSMAEVVQ+L+ I+
Sbjct:  633 EEFEQEIGRLGGLQHPNLSSFQGYYFSSTMQLILSEFVPNGSLYDNLHLRIFPGTSSSYGNTDLNWHRRFQIALGTAKALSFLHNDCKPAILHLNVKSTNILLDERYEAKLSDYGLEKFLPVMDSFGLTKKFHNAVGYIAPELAQQSLRASEKCDVYSYGVVLLELVTGRKPVESPSENQVLILRDYVRDLLETGSASDCFDRRLREFEENELIQVMKLGLLCTSENPLKRPSMAEVVQVLESIR 877          
BLAST of EY756177 vs. ExPASy Swiss-Prot
Match: RCH2_ARATH (Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.489e-43
Identity = 94/237 (39.66%), Postives = 144/237 (60.76%), Query Frame = 3
Query:   12 EDFYREVRVLGKARHPNLISLVGHYWTPQLKLLVSDYAPNGSLQAKLHERLPSTPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEYGEDNVVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQVIK 722
            + F  EV+ LG  RH N++  +G  W    +LL+ DY PNGSL + LHER  S+  L W  R++++LG A+GLA+LHH   PPI+H ++K +NIL+  ++ P I+DFGLA+L+   D    SN    + GY+APE    S+++ EK D+Y +GV++LE++TG++P++      + L + VR       VLD    S  +   DE++ VL  AL+C    P  RP+M +V  +L+ IK
Sbjct:  834 DSFSAEVKTLGTIRHKNIVRFLGCCWNRNTRLLMYDYMPNGSLGSLLHERRGSS--LDWDLRYRILLGAAQGLAYLHHDCLPPIVHRDIKANNILIGLDFEPYIADFGLAKLVDEGDIGRCSNTVAGSYGYIAPEYG-YSMKITEKSDVYSYGVVVLEVLTGKQPIDPTVPEGIHLVDWVRQNRGSLEVLDSTLRSRTEAEADEMMQVLGTALLCVNSSPDERPTMKDVAAMLKEIK 1067          
BLAST of EY756177 vs. ExPASy Swiss-Prot
Match: Y1154_ARATH (Probable serine/threonine-protein kinase At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2)

HSP 1 Score: 175.252 bits (443), Expect = 4.331e-43
Identity = 94/239 (39.33%), Postives = 144/239 (60.25%), Query Frame = 3
Query:   12 EDFYREVRVLGKARHPNLISLVGHYWTPQLKLLVSDYAPNGSLQAKLHERLPSTPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEY----GEDNVVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLP-VLKLALVCTCHIPSSRPSMAEVVQILQ 713
            ++F  EV V+G+ RH NL+ L+G+      ++LV D+  NG+L+  +H  +    PL+W  R  +ILG AKGLA+LH    P ++H ++K SNILLD  +N ++SDFGLA+LL     +V + R     GYVAPE  C  + +NEK DIY FG+LI+E++TGR PV+Y    GE N+V   + ++ ++      + VDP + + P  + L  VL +AL C     + RP M  ++ +L+
Sbjct:  193 KEFKVEVEVIGRVRHKNLVRLLGYCVEGAYRMLVYDFVDNGNLEQWIHGDVGDVSPLTWDIRMNIILGMAKGLAYLHEGLEPKVVHRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYV-TTRVMGTFGYVAPEYACTGM-LNEKSDIYSFGILIMEIITGRNPVDYSRPQGETNLV---DWLKSMVGNRRSEEVVDPKIPEPPSSKALKRVLLVALRCVDPDANKRPKMGHIIHMLE 426          
BLAST of EY756177 vs. ExPASy Swiss-Prot
Match: HSL1_ARATH (Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 5.657e-43
Identity = 102/239 (42.68%), Postives = 145/239 (60.67%), Query Frame = 3
Query:   12 EDFYREVRVLGKARHPNLISLVGHYWTPQLKLLVSDYAPNGSLQAKLHERLPSTPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMS-NRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPV--EYGEDNVVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQVI 719
            E F  EV  LGK RH N++ L     T   KLLV +Y PNGSL   LH        L W  RFK+IL  A+GL++LHH   PPI+H ++K +NIL+D +Y  R++DFG+A+ +    K   S +    + GY+APE    +LRVNEK DIY FGV+ILE+VT +RPV  E GE ++V   + V   L++  +   +DP +    ++E+  +L + L+CT  +P +RPSM  VV++LQ I
Sbjct:  730 EAFEAEVETLGKIRHKNIVKLWCCCSTRDCKLLVYEYMPNGSLGDLLHSSKGGM--LGWQTRFKIILDAAEGLSYLHHDSVPPIVHRDIKSNNILIDGDYGARVADFGVAKAVDLTGKAPKSMSVIAGSCGYIAPEY-AYTLRVNEKSDIYSFGVVILEIVTRKRPVDPELGEKDLV---KWVCSTLDQKGIEHVIDPKLDSCFKEEISKILNVGLLCTSPLPINRPSMRRVVKMLQEI 962          
BLAST of EY756177 vs. ExPASy Swiss-Prot
Match: EXS_ARATH (Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.149e-42
Identity = 94/238 (39.50%), Postives = 142/238 (59.66%), Query Frame = 3
Query:   15 DFYREVRVLGKARHPNLISLVGHYWTPQLKLLVSDYAPNGSLQAKLHERLPSTPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPV--EYGEDNVVILSEHVRVLLEEGNVLDCVDPSMGDYP-EDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQVI 719
            +F  E+  LGK +HPNL+SL+G+    + KLLV +Y  NGSL   L  +      L W+ R K+ +G A+GLA LHH F P IIH ++K SNILLD ++ P+++DFGLARL++  + HV S       GY+ PE   QS R   K D+Y FGV++LELVTG+ P   ++ E     L       + +G  +D +DP +     ++  L +L++A++C    P+ RP+M +V++ L+ I
Sbjct:  957 EFMAEMETLGKVKHPNLVSLLGYCSFSEEKLLVYEYMVNGSLDHWLRNQTGMLEVLDWSKRLKIAVGAARGLAFLHHGFIPHIIHRDIKASNILLDGDFEPKVADFGLARLISACESHV-STVIAGTFGYIPPEYG-QSARATTKGDVYSFGVILLELVTGKEPTGPDFKESEGGNLVGWAIQKINQGKAVDVIDPLLVSVALKNSQLRLLQIAMLCLAETPAKRPNMLDVLKALKEI 1192          
BLAST of EY756177 vs. ExPASy Swiss-Prot
Match: SERK1_ARATH (Somatic embryogenesis receptor kinase 1 OS=Arabidopsis thaliana GN=SERK1 PE=1 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 3.666e-42
Identity = 95/236 (40.25%), Postives = 148/236 (62.71%), Query Frame = 3
Query:   18 FYREVRVLGKARHPNLISLVGHYWTPQLKLLVSDYAPNGSLQAKLHERLPSTPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVE---YGEDNVVILSEHVRVLLEEGNVLDCVDPSM-GDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQ 713
            F  EV ++  A H NL+ L G   TP  +LLV  Y  NGS+ + L ER PS PPL W  R ++ LG+A+GL++LH    P IIH ++K +NILLD+ +   + DFGLA+L+   D HV +   +  +G++APE      + +EK D++G+G+++LEL+TG+R  +      D+ V+L + V+ LL+E  +   VDP +  +Y E E+  V+++AL+CT   P  RP M+EVV++L+
Sbjct:  344 FQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQPPLDWPTRKRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHV-TTAVRGTIGHIAPEYLSTG-KSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQTNYEERELEQVIQVALLCTQGSPMERPKMSEVVRMLE 577          
BLAST of EY756177 vs. ExPASy Swiss-Prot
Match: FEI1_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 6.254e-42
Identity = 99/242 (40.91%), Postives = 143/242 (59.09%), Query Frame = 3
Query:   18 FYREVRVLGKARHPNLISLVGHYWTPQLKLLVSDYAPNGSLQAKLHERLPSTPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVE--YGEDNVVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQ-VIKTPLP 734
            F RE+ +LG  +H  L++L G+  +P  KLL+ DY P GSL   LHER      L W +R  +I+G AKGL++LHH   P IIH ++K SNILLD N   R+SDFGLA+LL   + H+ +       GY+APE   QS R  EK D+Y FGVL+LE+++G+RP +  + E  + ++   ++ L+ E    D VDP+      + +  +L +A  C    P  RP+M  VVQ+L+  + TP P
Sbjct:  347 FERELEILGSIKHRYLVNLRGYCNSPTSKLLLYDYLPGGSLDEALHER---GEQLDWDSRVNIIIGAAKGLSYLHHDCSPRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHI-TTIVAGTFGYLAPEY-MQSGRATEKTDVYSFGVLVLEVLSGKRPTDASFIEKGLNVVG-WLKFLISEKRPRDIVDPNCEGMQMESLDALLSIATQCVSPSPEERPTMHRVVQLLESEVMTPCP 582          
BLAST of EY756177 vs. ExPASy Swiss-Prot
Match: BAK1_ARATH (BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 6.254e-42
Identity = 95/236 (40.25%), Postives = 148/236 (62.71%), Query Frame = 3
Query:   18 FYREVRVLGKARHPNLISLVGHYWTPQLKLLVSDYAPNGSLQAKLHERLPSTPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVE---YGEDNVVILSEHVRVLLEEGNVLDCVDPSM-GDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQ 713
            F  EV ++  A H NL+ L G   TP  +LLV  Y  NGS+ + L ER  S PPL W  R ++ LG+A+GLA+LH    P IIH ++K +NILLD+ +   + DFGLA+L+   D HV +   +  +G++APE      + +EK D++G+GV++LEL+TG+R  +      D+ V+L + V+ LL+E  +   VD  + G+Y ++EV  ++++AL+CT   P  RP M+EVV++L+
Sbjct:  331 FQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHV-TTAVRGTIGHIAPEYLSTG-KSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLE 564          
BLAST of EY756177 vs. ExPASy Swiss-Prot
Match: SERK2_ARATH (Somatic embryogenesis receptor kinase 2 OS=Arabidopsis thaliana GN=SERK2 PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.393e-41
Identity = 95/236 (40.25%), Postives = 149/236 (63.14%), Query Frame = 3
Query:   18 FYREVRVLGKARHPNLISLVGHYWTPQLKLLVSDYAPNGSLQAKLHERLPSTPPLSWTNRFKVILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVE---YGEDNVVILSEHVRVLLEEGNVLDCVDPSM-GDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQ 713
            F  EV ++  A H NL+ L G   TP  +LLV  Y  NGS+ + L ER PS  PL+W+ R ++ LG+A+GL++LH    P IIH ++K +NILLD+ +   + DFGLARL+   D HV +   +  +G++APE      + +EK D++G+G+++LEL+TG+R  +      D+ V+L + V+ LL+E  +   VDP +  +Y E EV  ++++AL+CT   P  RP M+EVV++L+
Sbjct:  347 FQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHV-TTAVRGTIGHIAPEYLSTG-KSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRMLE 580          
The following BLAST results are available for this feature:
BLAST of EY756177 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
Y3804_ARATH1.512e-10473.98Probably inactive leucine-rich repeat receptor-lik... [more]
Y1124_ARATH1.340e-6046.94Probable LRR receptor-like serine/threonine-protei... [more]
RCH2_ARATH1.489e-4339.66Receptor-like protein kinase 2 OS=Arabidopsis thal... [more]
Y1154_ARATH4.331e-4339.33Probable serine/threonine-protein kinase At1g01540... [more]
HSL1_ARATH5.657e-4342.68Receptor-like protein kinase HSL1 OS=Arabidopsis t... [more]
EXS_ARATH2.149e-4239.50Leucine-rich repeat receptor protein kinase EXS OS... [more]
SERK1_ARATH3.666e-4240.25Somatic embryogenesis receptor kinase 1 OS=Arabido... [more]
FEI1_ARATH6.254e-4240.91LRR receptor-like serine/threonine-protein kinase ... [more]
BAK1_ARATH6.254e-4240.25BRASSINOSTEROID INSENSITIVE 1-associated receptor ... [more]
SERK2_ARATH1.393e-4140.25Somatic embryogenesis receptor kinase 2 OS=Arabido... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-E08-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756177 ID=EY756177|Name=EY756177|organism=Citrus sinensis|type=EST|length=901bp
CCACGCGTCCGGAAGACTTTTACAGGGAAGTTCGAGTCTTGGGAAAAGCA
AGGCACCCAAATTTGATATCACTGGTTGGACACTACTGGACTCCTCAGTT
GAAGCTTTTGGTGTCTGATTATGCACCAAACGGTAGCTTGCAAGCCAAAC
TCCATGAAAGGCTTCCTTCTACTCCACCGCTTTCTTGGACTAACAGATTC
AAAGTAATCCTCGGAACAGCAAAAGGCCTTGCTCATTTGCACCATTCTTT
CCGCCCACCCATTATTCATTACAACCTAAAACCAAGCAACATCTTGCTTG
ATGACAATTACAACCCAAGGATTTCAGACTTTGGATTGGCGAGGCTTTTG
ACCAGGCTCGACAAACACGTAATGAGCAACAGATTTCAGAGCGCACTAGG
GTATGTGGCACCAGAATTAACATGCCAGAGCTTAAGAGTGAATGAGAAAT
GTGACATATATGGTTTTGGGGTTTTAATACTTGAGCTTGTAACTGGTAGA
AGGCCTGTTGAATATGGTGAAGACAATGTAGTGATATTAAGCGAGCATGT
GAGAGTTCTTCTGGAAGAGGGCAACGTGTTAGATTGTGTTGATCCAAGCA
TGGGAGATTACCCAGAAGATGAGGTCTTACCGGTGCTCAAATTGGCCCTT
GTCTGCACTTGTCATATACCATCAAGCAGGCCTTCAATGGCAGAGGTTGT
CCAAATATTGCAAGTCATCAAAACCCCACTTCCACAGAGAATGGAGGTAT
TCTAAAACACCAATGGTGCTGCCCTGATCANNTATTTCTGATATNGNTTN
NNCTATCTTATTTTCATTTAGATTGATACAAATTATGCTGCTANTTAGCT
TGNATTTTTGTTATAAATTTCTAGNNATTGCATATTCACATTTGACATTA
T
back to top