EY756174

Overview
NameEY756174
Unique NameEY756174
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length342
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10319 contig Csv1_Contig10319:930..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756174 vs. ExPASy Swiss-Prot
Match: PER70_MAIZE (Peroxidase 70 OS=Zea mays GN=PER70 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.127e-12
Identity = 32/54 (59.26%), Postives = 42/54 (77.78%), Query Frame = 1
Query:   13 KKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 174
            ++GLLHSDQ+LFNG + D LV+ YA++   F +DFA  MI+MGNI PLTG+ GQ
Sbjct:  259 QRGLLHSDQQLFNGGATDGLVRTYASTPRRFSRDFAAAMIRMGNISPLTGTQGQ 312          
BLAST of EY756174 vs. ExPASy Swiss-Prot
Match: PERP7_BRARA (Peroxidase P7 OS=Brassica rapa PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 1.142e-11
Identity = 33/54 (61.11%), Postives = 41/54 (75.93%), Query Frame = 1
Query:   13 KKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 174
            ++GLLHSDQ LFNG S D +V+ Y+ S S F  DFA  MIKMG+I PLTGS+G+
Sbjct:  234 QRGLLHSDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGE 287          
BLAST of EY756174 vs. ExPASy Swiss-Prot
Match: PER67_ARATH (Peroxidase 67 OS=Arabidopsis thaliana GN=PER67 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.492e-11
Identity = 33/54 (61.11%), Postives = 40/54 (74.07%), Query Frame = 1
Query:   13 KKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 174
            KKGLL SDQ LFN    D LV  Y+ +++ F++DFAR MIKMG+I PLTGS GQ
Sbjct:  254 KKGLLTSDQVLFNNGPTDSLVIAYSHNLNAFYRDFARAMIKMGDISPLTGSNGQ 307          
BLAST of EY756174 vs. ExPASy Swiss-Prot
Match: PER1_ARAHY (Cationic peroxidase 1 OS=Arachis hypogaea GN=PNC1 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.492e-11
Identity = 32/54 (59.26%), Postives = 39/54 (72.22%), Query Frame = 1
Query:   13 KKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 174
            KKGLLHSDQ+LFNG S D  V  Y+ + + F  DF   MIKMGN+ PLTG++GQ
Sbjct:  254 KKGLLHSDQQLFNGVSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQ 307          
BLAST of EY756174 vs. ExPASy Swiss-Prot
Match: PER68_ARATH (Peroxidase 68 OS=Arabidopsis thaliana GN=PER68 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.948e-11
Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
Query:    7 VRKKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 174
            V  +GLL SDQ LFNG S D +V  Y+ S+  F++DF   MIKMG+I PLTGS GQ
Sbjct:  261 VNHRGLLTSDQVLFNGGSTDSIVVSYSRSVQAFYRDFVAAMIKMGDISPLTGSNGQ 316          
BLAST of EY756174 vs. ExPASy Swiss-Prot
Match: PER4_VITVI (Peroxidase 4 OS=Vitis vinifera GN=GSVIVT00023967001 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.948e-11
Identity = 32/56 (57.14%), Postives = 38/56 (67.86%), Query Frame = 1
Query:    7 VRKKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 174
            + +KGLLHSDQ L+NG S D  VK Y  +   F  DF  GMIKMG+I PLTGS G+
Sbjct:  257 INQKGLLHSDQVLYNGGSTDSTVKTYVNNPKTFTSDFVAGMIKMGDITPLTGSEGE 312          
BLAST of EY756174 vs. ExPASy Swiss-Prot
Match: PER66_MAIZE (Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.669e-11
Identity = 31/54 (57.41%), Postives = 38/54 (70.37%), Query Frame = 1
Query:   13 KKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 174
            +KGLLHSDQELFN  S D  V+ +A+S S F   FA  M+KMGN+ P TG+ GQ
Sbjct:  257 QKGLLHSDQELFNSGSTDSTVRSFASSTSAFNSAFATAMVKMGNLSPQTGTQGQ 310          
BLAST of EY756174 vs. ExPASy Swiss-Prot
Match: PER52_ARATH (Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.404e-11
Identity = 31/54 (57.41%), Postives = 40/54 (74.07%), Query Frame = 1
Query:   13 KKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 174
            ++GLLHSDQ LFNG S D +V+ Y+ + S F  DF   MIKMG+I PLTGS+G+
Sbjct:  262 QRGLLHSDQVLFNGGSTDSIVRGYSNNPSSFNSDFTAAMIKMGDISPLTGSSGE 315          
BLAST of EY756174 vs. ExPASy Swiss-Prot
Match: PER42_MAIZE (Peroxidase 42 OS=Zea mays GN=PER42 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.670e-11
Identity = 30/54 (55.56%), Postives = 38/54 (70.37%), Query Frame = 1
Query:   13 KKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQ 174
            +KGLLHSDQELFN  S D  V  +A+S + F   F   M+KMGN+ PLTG++GQ
Sbjct:  257 QKGLLHSDQELFNNGSTDSTVSNFASSSAAFTSAFTAAMVKMGNLGPLTGTSGQ 310          
The following BLAST results are available for this feature:
BLAST of EY756174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
PER70_MAIZE5.127e-1259.26Peroxidase 70 OS=Zea mays GN=PER70 PE=1 SV=1[more]
PERP7_BRARA1.142e-1161.11Peroxidase P7 OS=Brassica rapa PE=1 SV=3[more]
PER67_ARATH1.492e-1161.11Peroxidase 67 OS=Arabidopsis thaliana GN=PER67 PE=... [more]
PER1_ARAHY1.492e-1159.26Cationic peroxidase 1 OS=Arachis hypogaea GN=PNC1 ... [more]
PER68_ARATH1.948e-1157.14Peroxidase 68 OS=Arabidopsis thaliana GN=PER68 PE=... [more]
PER4_VITVI1.948e-1157.14Peroxidase 4 OS=Vitis vinifera GN=GSVIVT0002396700... [more]
PER66_MAIZE5.669e-1157.41Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1[more]
PER52_ARATH7.404e-1157.41Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=... [more]
PER42_MAIZE9.670e-1155.56Peroxidase 42 OS=Zea mays GN=PER42 PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-E05-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756174 ID=EY756174|Name=EY756174|organism=Citrus sinensis|type=EST|length=342bp
CCACGCGTCCGCAAGAAGGGGCTTCTTCATTCTGACCAAGAGCTCTTTAA
TGGCAATTCTGCTGATTTTCTGGTCAAAAGATACGCTGCTAGCATCTCTG
TTTTTTTCAAGGACTTCGCCAGGGGTATGATCAAGATGGGCAACATCAAA
CCTCTCACAGGAAGTGCTGGACAGATCAGGATCAATTGCAGAAAAATCAA
TTGAAAAATTATCTGCATCTTGTAATAAGCTACAATATTTCTAATATGAA
CATGTGTGGCGTTGTACGTAAACAGAGTATTAATGATTGCAGCAGCCAAT
CGTTATATCTGATTAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top