EY756171

Overview
NameEY756171
Unique NameEY756171
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length736
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig239 contig Csv1_Contig239:392..1130. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756171 vs. ExPASy Swiss-Prot
Match: TIP11_ARATH (Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1 PE=1 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 6.032e-79
Identity = 137/168 (81.55%), Postives = 151/168 (89.88%), Query Frame = 1
Query:   13 VNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 516
            VNPAVTFGAF+GGNI+LLRGILYWIAQLLGS VACL+LKF T G    AF LS+GVG  NA VFEIVMTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF GASMNPAV+FGPA+VSW+W NHWVYW GPL+GGG+AG++YE FFIN +HEQLPTT+Y
Sbjct:   84 VNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQLPTTDY 251          
BLAST of EY756171 vs. ExPASy Swiss-Prot
Match: TIP11_ORYSJ (Probable aquaporin TIP1-1 OS=Oryza sativa subsp. japonica GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 1.643e-76
Identity = 136/168 (80.95%), Postives = 149/168 (88.69%), Query Frame = 1
Query:   13 VNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 516
            VNPAVTFGAFVGGNI+L RG+LYWIAQLLGSTVAC LL+F T G  T  F L+ GV  W A+V EIVMTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANIL GGAFDGASMNPAVSFGPALVSWSW++ WVYWVGPLIGGGLAG++YE  FI+ +HEQLPTT+Y
Sbjct:   84 VNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFLLRFSTGGLATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWSWESQWVYWVGPLIGGGLAGVIYEVLFISHTHEQLPTTDY 250          
BLAST of EY756171 vs. ExPASy Swiss-Prot
Match: TIP11_MAIZE (Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.065e-75
Identity = 134/168 (79.76%), Postives = 147/168 (87.50%), Query Frame = 1
Query:   13 VNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 516
            VNPAVTFGAFVGGNI+L RG+LYW+AQLLGSTVAC LL+F T GQ T  F L+ GV  W A+V EIVMTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANIL GGAFDGASMNPAVSFGPALVSW W   WVYWVGPLIGGGLAG++YE  FI+ +HEQLP+T+Y
Sbjct:   84 VNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFLLRFSTGGQATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFISHTHEQLPSTDY 250          
BLAST of EY756171 vs. ExPASy Swiss-Prot
Match: TIP12_ARATH (Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2 PE=1 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 2.372e-75
Identity = 134/169 (79.29%), Postives = 150/169 (88.76%), Query Frame = 1
Query:   13 VNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQ-SHEQLPTTEY 516
            VNPAVTFG  +GGNI+LLRGILYWIAQLLGS  AC LL F T G+   AF LS+GVG+ NA+VFEIVMTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF GASMNPAV+FGPA+VSW+W NHWVYW GPLIGGGLAGI+Y+F FI++ +HEQLPTT+Y
Sbjct:   85 VNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTTDY 253          
BLAST of EY756171 vs. ExPASy Swiss-Prot
Match: TIP12_ORYSJ (Probable aquaporin TIP1-2 OS=Oryza sativa subsp. japonica GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 4.946e-73
Identity = 128/169 (75.74%), Postives = 146/169 (86.39%), Query Frame = 1
Query:   13 VNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQ-SHEQLPTTEY 516
            VNPAVTFGAFVGGNISL++ ++YW+AQLLGS VACLLLK  T G    AF+LS+GVGAWNAVVFEIVMTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAFDGASMNPAVSFGPA+V+  WDNHWVYW+GP +G  +A ++Y+  FI Q  H+QLPT +Y
Sbjct:   84 VNPAVTFGAFVGGNISLVKAVVYWVAQLLGSVVACLLLKIATGGAAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTGVWDNHWVYWLGPFVGAAIAALIYDIIFIGQRPHDQLPTADY 252          
BLAST of EY756171 vs. ExPASy Swiss-Prot
Match: TIP1_MEDTR (Probable aquaporin TIP-type OS=Medicago truncatula GN=AQP1 PE=1 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 6.046e-71
Identity = 132/168 (78.57%), Postives = 144/168 (85.71%), Query Frame = 1
Query:   13 VNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 516
            VNPAVTFGAFVGGNI+LLRGI+Y IAQLLGS VA  LL FVT   +  AF LS GVG   A+V EIVMTFGLVYTVYATA+DPKKG++G IAPIAIGFIVGANIL GGAF GASMNPAVSFGPA+VSWSW NHWVYW GPLIGGG+AG+VYE  FIN +HEQLPTT+Y
Sbjct:   84 VNPAVTFGAFVGGNITLLRGIVYIIAQLLGSIVASALLVFVT-ASSVPAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQLPTTDY 250          
BLAST of EY756171 vs. ExPASy Swiss-Prot
Match: TIP13_ARATH (Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3 PE=1 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 3.000e-70
Identity = 127/169 (75.15%), Postives = 142/169 (84.02%), Query Frame = 1
Query:   13 VNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFI-NQSHEQLPTTEY 516
            VNPAVTFGAF+GGNI+LLR ILYWIAQLLG+ VACLLLK  T G  T+AF+LS GV  WNAVVFEIVMTFGLVYTVYATA+DPKKG +G IAP+AIG IVGANIL GGAFDGASMNPAVSFGPA+VSW W NHWVYWVGP IG  +A IVY+  FI +  HE LP+ ++
Sbjct:   84 VNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMNPAVSFGPAVVSWIWTNHWVYWVGPFIGAAIAAIVYDTIFIGSNGHEPLPSNDF 252          
BLAST of EY756171 vs. ExPASy Swiss-Prot
Match: TIP12_MAIZE (Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 3.000e-70
Identity = 128/167 (76.65%), Postives = 143/167 (85.63%), Query Frame = 1
Query:   13 VNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQ-SHEQLPTT 510
            VNPAVTFGAFVGGNISLL+ ++YW+AQLLGS VACLLLK  T G    AF+LS+GVGA NAVV E+VMTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAFDGASMNPAVSFGPA+V+  W+NHWVYWVGPL G  +A +VY+  FI Q  H+QLPTT
Sbjct:   84 VNPAVTFGAFVGGNISLLKALVYWVAQLLGSVVACLLLKIATGGAALGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTGVWENHWVYWVGPLAGAAIAALVYDIIFIGQRPHQQLPTT 250          
BLAST of EY756171 vs. ExPASy Swiss-Prot
Match: TIP1_MEDSA (Probable aquaporin TIP-type OS=Medicago sativa GN=MCP1 PE=2 SV=2)

HSP 1 Score: 259.225 bits (661), Expect = 1.646e-68
Identity = 130/168 (77.38%), Postives = 142/168 (84.52%), Query Frame = 1
Query:   13 VNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 516
            VNPAV FGAFVGGNI+LLRGI+Y IAQLLGS V   LL FVT   +  AF LS GVG   A+V EIVMTFGLVYTVYATA+DPKKG++G IAPIAIGFIVGANIL GGAF GASMNPAVSFGPA+VSWSW NHWVYW GPLIGGG+AG+VYE  FIN +HEQLPTT+Y
Sbjct:   84 VNPAV-FGAFVGGNITLLRGIVYIIAQLLGSIVCSALLVFVT-ASSVPAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQLPTTDY 249          
BLAST of EY756171 vs. ExPASy Swiss-Prot
Match: TIP31_MAIZE (Aquaporin TIP3-1 OS=Zea mays GN=TIP3-1 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.397e-59
Identity = 102/164 (62.20%), Postives = 127/164 (77.44%), Query Frame = 1
Query:   13 VNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLP 504
            VNPAVTFGA VGG +SL+R +LYW+AQLLG+  A LLL+  T G     FAL+SGVG W+AV+ E VMTFGL+Y  YAT +DPK+G +GTIAP+A+GF++GAN+LAGG FDGA MNPA  FGPALV W W +HWVYW+GP +G GLAG+VYE+  I  +   +P
Sbjct:   88 VNPAVTFGALVGGRVSLVRAVLYWVAQLLGAVAATLLLRLATGGMRPPGFALASGVGDWHAVLLEAVMTFGLMYAYYATVIDPKRGHVGTIAPLAVGFLLGANVLAGGPFDGAGMNPARVFGPALVGWRWRHHWVYWLGPFLGAGLAGLVYEYLVIPSADAAVP 251          
The following BLAST results are available for this feature:
BLAST of EY756171 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 174
Match NameE-valueIdentityDescription
TIP11_ARATH6.032e-7981.55Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1... [more]
TIP11_ORYSJ1.643e-7680.95Probable aquaporin TIP1-1 OS=Oryza sativa subsp. j... [more]
TIP11_MAIZE1.065e-7579.76Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1[more]
TIP12_ARATH2.372e-7579.29Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2... [more]
TIP12_ORYSJ4.946e-7375.74Probable aquaporin TIP1-2 OS=Oryza sativa subsp. j... [more]
TIP1_MEDTR6.046e-7178.57Probable aquaporin TIP-type OS=Medicago truncatula... [more]
TIP13_ARATH3.000e-7075.15Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3... [more]
TIP12_MAIZE3.000e-7076.65Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1[more]
TIP1_MEDSA1.646e-6877.38Probable aquaporin TIP-type OS=Medicago sativa GN=... [more]
TIP31_MAIZE1.397e-5962.20Aquaporin TIP3-1 OS=Zea mays GN=TIP3-1 PE=2 SV=1[more]

Pages

back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-E02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756171 ID=EY756171|Name=EY756171|organism=Citrus sinensis|type=EST|length=736bp
CCACGCGTCCGCGTTAATCCTGCTGTCACCTTTGGCGCCTTCGTTGGAGG
TAACATCTCCCTTCTACGAGGCATCCTCTACTGGATCGCCCAGCTTCTTG
GATCCACCGTCGCATGCTTGCTTCTTAAGTTCGTTACCAACGGCCAGACC
ACATCTGCTTTTGCTCTCTCATCTGGAGTTGGTGCATGGAACGCAGTCGT
TTTCGAGATCGTGATGACATTCGGACTAGTGTACACAGTGTATGCCACAG
CCCTGGACCCAAAGAAGGGAAGCTTGGGGACAATTGCACCAATTGCAATT
GGTTTCATTGTAGGAGCCAACATCTTGGCGGGCGGGGCGTTTGATGGAGC
TTCAATGAACCCAGCAGTGTCATTCGGGCCAGCTTTGGTAAGCTGGAGCT
GGGACAACCACTGGGTCTACTGGGTCGGGCCACTCATCGGTGGTGGGCTA
GCTGGCATCGTCTACGAGTTCTTCTTCATTAACCAGTCTCACGAGCAGCT
CCCAACAACCGAGTACTAAGCTAAAAGCTTGCCATCTATGTGAGTTTGCA
CGGATGTTGTATTTATTTGCTTTTACCCGAGGTCTTTCTTTTTATTTTAA
TTTGTGTTTAATTTATGGCCGTTGATCTGTTTCATCGTCATGAGCTGCTG
GATTATTGTATCGCGATAATTATGGAGTCCCANGCTATGGCTTTGNATTT
CTACTCGCACTTCAATTGCTTTGATGNCTAANNNNN
back to top