EY756169

Overview
NameEY756169
Unique NameEY756169
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length439
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13310 contig Csv1_Contig13310:1..439. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756169 vs. ExPASy Swiss-Prot
Match: H4_SILLA (Histone H4 OS=Silene latifolia GN=SlH4 PE=3 SV=3)

HSP 1 Score: 120.168 bits (300), Expect = 3.767e-27
Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 2
Query:    5 ASGGGFTRISGLIYEETRGVLKIFLDNVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 199
            A  GG  RISGLIYEETRGVLKIFL+NVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   39 ARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of EY756169 vs. ExPASy Swiss-Prot
Match: H4_PEA (Histone H4 OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 3.767e-27
Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 2
Query:    5 ASGGGFTRISGLIYEETRGVLKIFLDNVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 199
            A  GG  RISGLIYEETRGVLKIFL+NVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   39 ARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of EY756169 vs. ExPASy Swiss-Prot
Match: H4_MAIZE (Histone H4 OS=Zea mays GN=H4C7 PE=1 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 3.767e-27
Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 2
Query:    5 ASGGGFTRISGLIYEETRGVLKIFLDNVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 199
            A  GG  RISGLIYEETRGVLKIFL+NVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   39 ARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of EY756169 vs. ExPASy Swiss-Prot
Match: H4_LOLTE (Histone H4 OS=Lolium temulentum PE=3 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 3.767e-27
Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 2
Query:    5 ASGGGFTRISGLIYEETRGVLKIFLDNVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 199
            A  GG  RISGLIYEETRGVLKIFL+NVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   39 ARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of EY756169 vs. ExPASy Swiss-Prot
Match: H4_FLATR (Histone H4 OS=Flaveria trinervia GN=hh4 PE=3 SV=3)

HSP 1 Score: 120.168 bits (300), Expect = 3.767e-27
Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 2
Query:    5 ASGGGFTRISGLIYEETRGVLKIFLDNVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 199
            A  GG  RISGLIYEETRGVLKIFL+NVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   39 ARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of EY756169 vs. ExPASy Swiss-Prot
Match: H4_EUCGL (Histone H4 OS=Eucalyptus globulus PE=3 SV=3)

HSP 1 Score: 120.168 bits (300), Expect = 3.767e-27
Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 2
Query:    5 ASGGGFTRISGLIYEETRGVLKIFLDNVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 199
            A  GG  RISGLIYEETRGVLKIFL+NVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   39 ARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of EY756169 vs. ExPASy Swiss-Prot
Match: H4_CHEMJ (Histone H4 OS=Chelidonium majus PE=3 SV=3)

HSP 1 Score: 120.168 bits (300), Expect = 3.767e-27
Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 2
Query:    5 ASGGGFTRISGLIYEETRGVLKIFLDNVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 199
            A  GG  RISGLIYEETRGVLKIFL+NVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   39 ARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of EY756169 vs. ExPASy Swiss-Prot
Match: H4_ARATH (Histone H4 OS=Arabidopsis thaliana GN=At1g07660 PE=1 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 3.767e-27
Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 2
Query:    5 ASGGGFTRISGLIYEETRGVLKIFLDNVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 199
            A  GG  RISGLIYEETRGVLKIFL+NVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   39 ARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of EY756169 vs. ExPASy Swiss-Prot
Match: H42_WHEAT (Histone H4 variant TH091 OS=Triticum aestivum PE=3 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 3.767e-27
Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 2
Query:    5 ASGGGFTRISGLIYEETRGVLKIFLDNVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 199
            A  GG  RISGLIYEETRGVLKIFL+NVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   39 ARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of EY756169 vs. ExPASy Swiss-Prot
Match: H41_WHEAT (Histone H4 variant TH011 OS=Triticum aestivum PE=3 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 3.767e-27
Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 2
Query:    5 ASGGGFTRISGLIYEETRGVLKIFLDNVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 199
            A  GG  RISGLIYEETRGVLKIFL+NVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   39 ARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103          
The following BLAST results are available for this feature:
BLAST of EY756169 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 107
Match NameE-valueIdentityDescription
H4_SILLA3.767e-2792.31Histone H4 OS=Silene latifolia GN=SlH4 PE=3 SV=3[more]
H4_PEA3.767e-2792.31Histone H4 OS=Pisum sativum PE=1 SV=2[more]
H4_MAIZE3.767e-2792.31Histone H4 OS=Zea mays GN=H4C7 PE=1 SV=2[more]
H4_LOLTE3.767e-2792.31Histone H4 OS=Lolium temulentum PE=3 SV=2[more]
H4_FLATR3.767e-2792.31Histone H4 OS=Flaveria trinervia GN=hh4 PE=3 SV=3[more]
H4_EUCGL3.767e-2792.31Histone H4 OS=Eucalyptus globulus PE=3 SV=3[more]
H4_CHEMJ3.767e-2792.31Histone H4 OS=Chelidonium majus PE=3 SV=3[more]
H4_ARATH3.767e-2792.31Histone H4 OS=Arabidopsis thaliana GN=At1g07660 PE... [more]
H42_WHEAT3.767e-2792.31Histone H4 variant TH091 OS=Triticum aestivum PE=3... [more]
H41_WHEAT3.767e-2792.31Histone H4 variant TH011 OS=Triticum aestivum PE=3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-D12-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756169 ID=EY756169|Name=EY756169|organism=Citrus sinensis|type=EST|length=439bp
CCACGCGTCCGGAGGAGGCTTTACGAGAATCAGCGGTCTCATCTACGAGG
AGACACGCGGCGTCCTCAAGATCTTCTTGGACAACGTCATTCGCGATGCT
GTGACCTACACTGAGCACGCTCGCCGAAAGACGGTGACCGCCATGGATGT
CGTTTATGCGCTCAAGAGGCAGGGCAGGACTCTCTATGGGTTTGGTGGTT
GATGTGGCGTCGTTTTGTATTTTGTGTTTTAGGATTTTCCTTTTTTCCTG
TAAATCAGTGAATGTGGTTGTGTCTAGCGAGTGGGTTTAAATTGGAGGCA
ACTTGTATTTGCCGTTTCCTAGGGGTTTTTTTATTTTTTTGGTTCATTGG
TGTTTTCATCTTTGCAATGAGAATCTAGTTGTTTACTTCNNAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top