EY756168

Overview
NameEY756168
Unique NameEY756168
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length707
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9630 contig Csv1_Contig9630:802..1508. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756168 vs. ExPASy Swiss-Prot
Match: COMT1_CAPAN (Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 1.155e-23
Identity = 50/97 (51.55%), Postives = 67/97 (69.07%), Query Frame = 3
Query:   12 VLHYRNDEHCLKLLKNCYKSIP*DGKVIVVESMLPEVPNTSIESKSNSHLDVLMMIQSPGGKERTRHEFMTLATGAGFGGISCELAIGSLWVMEFYK 302
            + H  +DEHCLK LKNCY+++P +GKV+V E +LPE P+TS  +K+  H+D++M+  +PGGKERT  EF  LA GAGF G          WVMEF+K
Sbjct:  263 ICHDWSDEHCLKFLKNCYEALPANGKVLVAECILPETPDTSAATKNAVHVDIVMLAHNPGGKERTEKEFEALAKGAGFTGFRRACCAYQTWVMEFHK 359          
BLAST of EY756168 vs. ExPASy Swiss-Prot
Match: COMT1_ZINEL (Caffeic acid 3-O-methyltransferase OS=Zinnia elegans PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.361e-23
Identity = 51/97 (52.58%), Postives = 69/97 (71.13%), Query Frame = 3
Query:   12 VLHYRNDEHCLKLLKNCYKSIP*DGKVIVVESMLPEVPNTSIESKSNSHLDVLMMIQSPGGKERTRHEFMTLATGAGFGGISCELAIGSLWVMEFYK 302
            +LH  +D HCL++LKNCYKS+P +GKVIV E +LPE P+T+  +++  H+DV+M+  +PGGKERT  EF  LA GAGF G +      + WVMEF K
Sbjct:  258 ILHDWSDAHCLQVLKNCYKSLPENGKVIVAECILPEAPDTTPATQNVIHIDVIMLAHNPGGKERTEKEFEALAKGAGFKGFNKAACALNTWVMEFCK 354          
BLAST of EY756168 vs. ExPASy Swiss-Prot
Match: COMT1_MEDSA (Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.339e-22
Identity = 48/97 (49.48%), Postives = 67/97 (69.07%), Query Frame = 3
Query:   12 VLHYRNDEHCLKLLKNCYKSIP*DGKVIVVESMLPEVPNTSIESKSNSHLDVLMMIQSPGGKERTRHEFMTLATGAGFGGISCELAIGSLWVMEFYK 302
            + H  +DEHCLK LKNCY+++P +GKVIV E +LP  P++S+ +K   H+DV+M+  +PGGKERT+ EF  LA GAGF G        + ++MEF K
Sbjct:  267 ICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK 363          
BLAST of EY756168 vs. ExPASy Swiss-Prot
Match: COMT1_PRUDU (Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.409e-21
Identity = 47/97 (48.45%), Postives = 67/97 (69.07%), Query Frame = 3
Query:   12 VLHYRNDEHCLKLLKNCYKSIP*DGKVIVVESMLPEVPNTSIESKSNSHLDVLMMIQSPGGKERTRHEFMTLATGAGFGGISCELAIGSLWVMEFYK 302
            + H  +DEHCLK LKNCY ++P +GKVI+ E +LP  P++S+ +K   H+DV+M+  +PGGKERT  EF  LA GAGF G +   +  + +V+EF K
Sbjct:  267 ICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK 363          
BLAST of EY756168 vs. ExPASy Swiss-Prot
Match: COMT1_ROSCH (Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.366e-21
Identity = 48/97 (49.48%), Postives = 66/97 (68.04%), Query Frame = 3
Query:   12 VLHYRNDEHCLKLLKNCYKSIP*DGKVIVVESMLPEVPNTSIESKSNSHLDVLMMIQSPGGKERTRHEFMTLATGAGFGGISCELAIGSLWVMEFYK 302
            + H  +DEHCLK LKNCY ++P +GKVI+ E +LP  P+TS+ +K   H+DV+M+  +PGGKERT  EF  LA G+GF GI       + +V+EF K
Sbjct:  267 ICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDTSLATKGVVHIDVVMLAHNPGGKERTEQEFEALAKGSGFQGIRVACNAFNTYVIEFLK 363          
BLAST of EY756168 vs. ExPASy Swiss-Prot
Match: COMT1_COFCA (Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.153e-21
Identity = 46/97 (47.42%), Postives = 67/97 (69.07%), Query Frame = 3
Query:   12 VLHYRNDEHCLKLLKNCYKSIP*DGKVIVVESMLPEVPNTSIESKSNSHLDVLMMIQSPGGKERTRHEFMTLATGAGFGGISCELAIGSLWVMEFYK 302
            + H  +D+HC KLLKNCY+++P +GKVI+ E +LPE P+TS+ +++  H+DV+M+  +PGGKERT  EF  LA GAGF       +  + W+ME  K
Sbjct:  254 ICHDWSDDHCRKLLKNCYQALPDNGKVILAECVLPEAPDTSLATQNVVHVDVVMLAHNPGGKERTEKEFEALAKGAGFKEFRKVCSAVNTWIMELCK 350          
BLAST of EY756168 vs. ExPASy Swiss-Prot
Match: OMT2_CHRAE (Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.195e-20
Identity = 47/97 (48.45%), Postives = 66/97 (68.04%), Query Frame = 3
Query:   12 VLHYRNDEHCLKLLKNCYKSIP*DGKVIVVESMLPEVPNTSIESKSNSHLDVLMMIQSPGGKERTRHEFMTLATGAGFGGISCELAIGSLWVMEFYK 302
            + H  +DEHCLKLLKNCY ++P +GKVI+ E +LPEVP++S+ +K   H+DV+ +  +PGGKERT  EF  LA  AGF G        + +++EF K
Sbjct:  243 ICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVAHNPGGKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK 339          
BLAST of EY756168 vs. ExPASy Swiss-Prot
Match: OMT1_CHRAE (Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.195e-20
Identity = 47/97 (48.45%), Postives = 66/97 (68.04%), Query Frame = 3
Query:   12 VLHYRNDEHCLKLLKNCYKSIP*DGKVIVVESMLPEVPNTSIESKSNSHLDVLMMIQSPGGKERTRHEFMTLATGAGFGGISCELAIGSLWVMEFYK 302
            + H  +DEHCLKLLKNCY ++P +GKVI+ E +LPEVP++S+ +K   H+DV+ +  +PGGKERT  EF  LA  AGF G        + +++EF K
Sbjct:  243 ICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVAHNPGGKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK 339          
BLAST of EY756168 vs. ExPASy Swiss-Prot
Match: COMT2_POPTM (Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.195e-20
Identity = 48/97 (49.48%), Postives = 65/97 (67.01%), Query Frame = 3
Query:   12 VLHYRNDEHCLKLLKNCYKSIP*DGKVIVVESMLPEVPNTSIESKSNSHLDVLMMIQSPGGKERTRHEFMTLATGAGFGGISCELAIGSLWVMEFYK 302
            + H  +DEHCL  LKNCY ++P +GKVI+VE +LP  P+TS+ +K   H+DV+M+  +PGGKERT  EF +LA GAGF G        +  V+EF K
Sbjct:  266 ICHDWSDEHCLTFLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDVIMLAHNPGGKERTDREFESLARGAGFKGFEVMCCAFNTHVIEFRK 362          
BLAST of EY756168 vs. ExPASy Swiss-Prot
Match: COMT1_OCIBA (Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.195e-20
Identity = 45/97 (46.39%), Postives = 64/97 (65.98%), Query Frame = 3
Query:   12 VLHYRNDEHCLKLLKNCYKSIP*DGKVIVVESMLPEVPNTSIESKSNSHLDVLMMIQSPGGKERTRHEFMTLATGAGFGGISCELAIGSLWVMEFYK 302
            + H  +DEHC+K LKNCY ++P +GKVI+ E +LPE P+T + +K+  H+DV+M+  +PGGKERT  EF  LA  AGF   +      + W+ME  K
Sbjct:  265 ICHDWSDEHCVKFLKNCYDALPQNGKVILAECVLPEAPDTGLATKNVVHIDVIMLAHNPGGKERTEKEFQGLAKAAGFKQFNKACCAYNTWIMELLK 361          
The following BLAST results are available for this feature:
BLAST of EY756168 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
COMT1_CAPAN1.155e-2351.55Caffeic acid 3-O-methyltransferase OS=Capsicum ann... [more]
COMT1_ZINEL3.361e-2352.58Caffeic acid 3-O-methyltransferase OS=Zinnia elega... [more]
COMT1_MEDSA6.339e-2249.48Caffeic acid 3-O-methyltransferase OS=Medicago sat... [more]
COMT1_PRUDU2.409e-2148.45Caffeic acid 3-O-methyltransferase OS=Prunus dulci... [more]
COMT1_ROSCH5.366e-2149.48Caffeic acid 3-O-methyltransferase OS=Rosa chinens... [more]
COMT1_COFCA9.153e-2147.42Caffeic acid 3-O-methyltransferase OS=Coffea canep... [more]
OMT2_CHRAE1.195e-2048.45Quercetin 3-O-methyltransferase 2 OS=Chrysospleniu... [more]
OMT1_CHRAE1.195e-2048.45Quercetin 3-O-methyltransferase 1 OS=Chrysospleniu... [more]
COMT2_POPTM1.195e-2049.48Caffeic acid 3-O-methyltransferase 2 OS=Populus tr... [more]
COMT1_OCIBA1.195e-2046.39Caffeic acid 3-O-methyltransferase 1 OS=Ocimum bas... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-D11-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756168 ID=EY756168|Name=EY756168|organism=Citrus sinensis|type=EST|length=707bp
CCACGCGTCCGGTACTGCACTATCGGAATGATGAACATTGCTTGAAGTTG
TTGAAGAATTGCTACAAAAGCATCCCATAAGACGGAAAGGTAATCGTTGT
GGAGTCAATGCTTCCAGAAGTTCCTAATACAAGCATTGAATCAAAATCAA
ATTCCCATTTGGACGTGCTTATGATGATTCAAAGTCCCGGTGGAAAGGAG
AGAACAAGGCATGAATTCATGACCCTGGCTACTGGCGCTGGTTTTGGTGG
GATCAGTTGTGAACTTGCTATTGGTAGTCTCTGGGTTATGGAGTTCTATA
AGTAGAGTGCATGCCCATGCATCCTAGAAATAAAACAAATCTTGTGTTGA
TTGTCTTGCGTGTATCTCTTTCCAAGCATGCTGATATGTCTCCCAAAGAC
GAGCAAGAACCCATGCATTTGACAAACTTCCCACGTACCTGATAGCCATG
CTTGAGAGGAGGAGTCTAGGACTTAATAATAAGTGCTTTGAAATAAATGG
GTGCTTGACACGTGGTCTATCAACTATGTGTGCAATATTGTTACCCATAT
TTCCTATTATTTCTAGTATTTCATGTGTTATTGTCTAGGGTGTCTTTTGT
TGTTCCAAGGGCAGTTACTAGCGTAGATTGCGTGTTTCCAATTGGCTCTT
ATAAAAAGCCTAAAGCTATCTGAATAAAGGATGCAGAAAAATTATTTCNT
NNNNNNN
back to top