EY756166

Overview
NameEY756166
Unique NameEY756166
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length890
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756166 vs. ExPASy Swiss-Prot
Match: PBS1_ARATH (Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 8.016e-50
Identity = 108/199 (54.27%), Postives = 130/199 (65.33%), Query Frame = 3
Query:  255 QITAQTLTFRELAAATKNFRSESLLGEGGFGRVYKGYLESINQVVAIKQLDRNGVQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSVEDHLHGLLSFCRPLSWQETT*LEYKNENSSWGSKGIRVFT*QS*TTSYIPRFKMLKHFA*QRLSSQAI*FWLGQTGPVGD-TPMYLQGYGNYGYCAPD 848
            QI A T  FRELAAAT NF  ++ LGEGGFGRVYKG L+S  QVVA+KQLDRNG+QGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYE+MPLGS+EDHLH L      L W        + + ++  +KG+     ++        FK       +    +   F L + GP GD + +  +  G YGYCAP+
Sbjct:   68 QIAAHTFAFRELAAATMNFHPDTFLGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDW------NMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPE 260          
BLAST of EY756166 vs. ExPASy Swiss-Prot
Match: RLCK7_ARATH (Probable serine/threonine-protein kinase RLCKVII OS=Arabidopsis thaliana GN=At1g07870 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 1.198e-45
Identity = 104/204 (50.98%), Postives = 131/204 (64.22%), Query Frame = 3
Query:  249 SDQIT---AQTLTFRELAAATKNFRSESLLGEGGFGRVYKGYLESINQVVAIKQLDRNGVQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSVEDHLHGLLSFCRPLSWQETT*LEYKNENSSWGSKGIRVFT*QS*TTSYIPRFKMLKHFA*QRLSSQAI*FWLGQTGPVGD-TPMYLQGYGNYGYCAPD 848
            +DQ+T   AQT TF+ELA AT NFRS+  LGEGGFG+V+KG +E ++QVVAIKQLDRNGVQG REF+VEVL LSL  HPNLV LIG+CA+GDQRLLVYEYMP GS+EDHLH L S  +PL W        + + ++  ++G+     +          K       +    +   F L + GP GD T +  +  G YGYCAPD
Sbjct:   80 NDQVTGKKAQTFTFQELAEATGNFRSDCFLGEGGFGKVFKGTIEKLDQVVAIKQLDRNGVQGIREFVVEVLTLSLADHPNLVKLIGFCAEGDQRLLVYEYMPQGSLEDHLHVLPSGKKPLDWNT------RMKIAAGAARGLEYLHDRMTPPVIYRDLKCSNILLGEDYQPKLSDFGLAKVGPSGDKTHVSTRVMGTYGYCAPD 277          
BLAST of EY756166 vs. ExPASy Swiss-Prot
Match: Y1534_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 2.799e-37
Identity = 59/131 (45.04%), Postives = 76/131 (58.02%), Query Frame = 3
Query:  216 LRVKEASE-DGASDQITAQTLTFRELAAATKNFRSESLLGEGGFGRVYKGYLESINQVVAIKQLDRNGVQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSVEDHLHGLLSFCRPLSW 605
            LR K   E D  S ++   + + R++  AT NF S + +GEGGFG VYKG L     ++A+KQL     QGNREFL E+ M+S LHHPNLV L G C +G Q LLVYE++   S+   L G       L W
Sbjct:  592 LRSKSQMEKDFKSLELMIASFSLRQIKIATNNFDSANRIGEGGFGPVYKGKLFD-GTIIAVKQLSTGSKQGNREFLNEIGMISALHHPNLVKLYGCCVEGGQLLLVYEFVENNSLARALFGPQETQLRLDW 721          

HSP 2 Score: 75.485 bits (184), Expect = 2.799e-37
Identity = 32/56 (57.14%), Postives = 45/56 (80.36%), Query Frame = 1
Query:  616 LDWNTRMKIAAGAARGLEYLHDKAKPPVIYRDLKCSNILLDRGYHPKLSDFGLAKL 783
            LDW TR KI  G ARGL YLH++++  +++RD+K +N+LLD+  +PK+SDFGLAKL
Sbjct:  719 LDWPTRRKICIGVARGLAYLHEESRLKIVHRDIKATNVLLDKQLNPKISDFGLAKL 774          
BLAST of EY756166 vs. ExPASy Swiss-Prot
Match: Y5374_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana GN=At5g37450 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.646e-37
Identity = 52/108 (48.15%), Postives = 74/108 (68.52%), Query Frame = 3
Query:  279 FRELAAATKNFRSESLLGEGGFGRVYKGYLESINQVVAIKQLDRNGVQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSVEDHLHGLLSFCRPLS 602
            F EL +AT +F   S +G GG+G+VYKG+L     VVA+K+ ++  +QG +EF  E+ +LS LHH NLV+L+GYC    +++LVYEYMP GS++D L     F +PLS
Sbjct:  621 FTELDSATSSFSDLSQIGRGGYGKVYKGHLPG-GLVVAVKRAEQGSLQGQKEFFTEIELLSRLHHRNLVSLLGYCDQKGEQMLVYEYMPNGSLQDALSA--RFRQPLS 725          

HSP 2 Score: 74.3294 bits (181), Expect = 3.646e-37
Identity = 33/62 (53.23%), Postives = 49/62 (79.03%), Query Frame = 1
Query:  607 KKPLDWNTRMKIAAGAARGLEYLHDKAKPPVIYRDLKCSNILLDRGYHPKLSDFGLAKLVLL 792
            ++PL    R++IA G+ARG+ YLH +A PP+I+RD+K SNILLD   +PK++DFG++KL+ L
Sbjct:  721 RQPLSLALRLRIALGSARGILYLHTEADPPIIHRDIKPSNILLDSKMNPKVADFGISKLIAL 782          
BLAST of EY756166 vs. ExPASy Swiss-Prot
Match: Y1684_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g06840 OS=Arabidopsis thaliana GN=At1g06840 PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 6.188e-37
Identity = 49/101 (48.51%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  267 QTLTFRELAAATKNFRSESLLGEGGFGRVYKGYLESINQVVAIKQLDRNGVQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSVEDHL 569
            ++ T+ ELA AT NF S + +G+GG+G+VYKG L S   VVAIK+     +QG +EFL E+ +LS LHH NLV+L+G+C +  +++LVYEYM  G++ D++
Sbjct:  611 KSFTYAELALATDNFNSSTQIGQGGYGKVYKGTLGS-GTVVAIKRAQEGSLQGEKEFLTEIELLSRLHHRNLVSLLGFCDEEGEQMLVYEYMENGTLRDNI 710          

HSP 2 Score: 72.4034 bits (176), Expect = 6.188e-37
Identity = 31/59 (52.54%), Postives = 47/59 (79.66%), Query Frame = 1
Query:  607 KKPLDWNTRMKIAAGAARGLEYLHDKAKPPVIYRDLKCSNILLDRGYHPKLSDFGLAKL 783
            K+PLD+  R++IA G+A+G+ YLH +A PP+ +RD+K SNILLD  +  K++DFGL++L
Sbjct:  715 KEPLDFAMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSRFTAKVADFGLSRL 773          
BLAST of EY756166 vs. ExPASy Swiss-Prot
Match: Y1154_ARATH (Probable serine/threonine-protein kinase At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 2.341e-36
Identity = 48/110 (43.64%), Postives = 70/110 (63.64%), Query Frame = 3
Query:  276 TFRELAAATKNFRSESLLGEGGFGRVYKGYLESINQVVAIKQLDRNGVQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSVEDHLHGLLSFCRPLSW 605
            T REL AAT     E+++GEGG+G VY+G L    +V A+K L  N  Q  +EF VEV ++  + H NLV L+GYC +G  R+LVY+++  G++E  +HG +    PL+W
Sbjct:  143 TLRELEAATNGLCEENVIGEGGYGIVYRGILTDGTKV-AVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCVEGAYRMLVYDFVDNGNLEQWIHGDVGDVSPLTW 251          

HSP 2 Score: 78.1814 bits (191), Expect = 2.341e-36
Identity = 40/76 (52.63%), Postives = 51/76 (67.11%), Query Frame = 1
Query:  613 PLDWNTRMKIAAGAARGLEYLHDKAKPPVIYRDLKCSNILLDRGYHPKLSDFGLAKLVLLVIHPCIYRVMGTMDTV 840
            PL W+ RM I  G A+GL YLH+  +P V++RD+K SNILLDR ++ K+SDFGLAKL+         RVMGT   V
Sbjct:  248 PLTWDIRMNIILGMAKGLAYLHEGLEPKVVHRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYVTTRVMGTFGYV 323          
BLAST of EY756166 vs. ExPASy Swiss-Prot
Match: BRI1_ARATH (Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.928e-36
Identity = 60/129 (46.51%), Postives = 80/129 (62.02%), Query Frame = 3
Query:  222 VKEA-SEDGASDQITAQTLTFRELAAATKNFRSESLLGEGGFGRVYKGYLESINQVVAIKQLDRNGVQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSVEDHLHGLLSFCRPLSW 605
            VKEA S + A+ +   + LTF +L  AT  F ++SL+G GGFG VYK  L+     VAIK+L     QG+REF+ E+  +  + H NLV L+GYC  GD+RLLVYE+M  GS+ED LH        L+W
Sbjct:  853 VKEALSINLAAFEKPLRKLTFADLLQATNGFHNDSLIGSGGFGDVYKAILKD-GSAVAIKKLIHVSGQGDREFMAEMETIGKIKHRNLVPLLGYCKVGDERLLVYEFMKYGSLEDVLHDPKKAGVKLNW 980          

HSP 2 Score: 70.8626 bits (172), Expect = 3.928e-36
Identity = 35/78 (44.87%), Postives = 48/78 (61.54%), Query Frame = 1
Query:  616 LDWNTRMKIAAGAARGLEYLHDKAKPPVIYRDLKCSNILLDRGYHPKLSDFGLAKLVLLVIHPCIYRVMGTMDTVLQI 849
            L+W+TR KIA G+ARGL +LH    P +I+RD+K SN+LLD     ++SDFG+A            R+M  MDT L +
Sbjct:  978 LNWSTRRKIAIGSARGLAFLHHNCSPHIIHRDMKSSNVLLDENLEARVSDFGMA------------RLMSAMDTHLSV 1043          
BLAST of EY756166 vs. ExPASy Swiss-Prot
Match: Y4245_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g20450 OS=Arabidopsis thaliana GN=At4g20450 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 8.709e-36
Identity = 57/132 (43.18%), Postives = 80/132 (60.61%), Query Frame = 3
Query:  216 LRVKEASEDGASDQIT-AQTLTFRELAAATKNFRSESLLGEGGFGRVYKGYLESINQVVAIKQLDRNGVQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSVEDHLHGLLSFCRPLSWQ 608
            LR K+ S+   S  +   ++ T+ E+A  T NF  E  LGEGGFG VY G +   N+ VA+K L  +  QG ++F  EV +L  +HH NLV L+GYC +G   +L+YEYM  G+++ HL G  S   PLSW+
Sbjct:  561 LRKKKPSKASRSSMVANKRSYTYEEVAVITNNF--ERPLGEGGFGVVYHGNVND-NEQVAVKVLSESSAQGYKQFKAEVDLLLRVHHINLVTLVGYCDEGQHLVLIYEYMSNGNLKQHLSGENS-RSPLSWE 688          

HSP 2 Score: 73.559 bits (179), Expect = 8.709e-36
Identity = 32/58 (55.17%), Postives = 42/58 (72.41%), Query Frame = 1
Query:  607 KKPLDWNTRMKIAAGAARGLEYLHDKAKPPVIYRDLKCSNILLDRGYHPKLSDFGLAK 780
            + PL W  R++IAA  A+GLEYLH   KPP+I+RD+K  NILLD  +  KL DFGL++
Sbjct:  682 RSPLSWENRLRIAAETAQGLEYLHIGCKPPMIHRDIKSMNILLDNNFQAKLGDFGLSR 739          
BLAST of EY756166 vs. ExPASy Swiss-Prot
Match: Y5343_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.133e-35
Identity = 58/138 (42.03%), Postives = 76/138 (55.07%), Query Frame = 3
Query:  198 LKMNSSLRVKEASEDGASDQITAQT--LTFRELAAATKNFRSESLLGEGGFGRVYKGYLESINQVVAIKQLDRNGVQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSVEDHLHGLLSFCRPLSW 605
            L++   L  KE  E+     +  QT   T +++  AT NF  E+ +GEGGFG VYKG L      +A+KQL     QGNREF+ E+ M+S L HPNLV L G C +G + LLVYEY+   S+   L G       L W
Sbjct:  630 LRLTGYLGGKEVDENEELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLAD-GMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDW 766          

HSP 2 Score: 70.8626 bits (172), Expect = 1.133e-35
Identity = 30/56 (53.57%), Postives = 44/56 (78.57%), Query Frame = 1
Query:  616 LDWNTRMKIAAGAARGLEYLHDKAKPPVIYRDLKCSNILLDRGYHPKLSDFGLAKL 783
            LDW+TR KI  G A+GL YLH++++  +++RD+K +N+LLD   + K+SDFGLAKL
Sbjct:  764 LDWSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKL 819          
BLAST of EY756166 vs. ExPASy Swiss-Prot
Match: Y5977_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.134e-35
Identity = 49/114 (42.98%), Postives = 73/114 (64.04%), Query Frame = 3
Query:  234 SEDGASDQITAQTLTFRELAAATKNFRSESLLGEGGFGRVYKGYLESINQVVAIKQLDRNGVQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSVEDHLHG 575
            +E  A   +  +  TF EL+  T NF   + +G GG+G+VYKG L +  QV+AIK+  +  +QG  EF  E+ +LS +HH N+V L+G+C D  +++LVYEY+P GS+ D L G
Sbjct:  609 NEMDAPQLMGTKAFTFEELSKCTNNFSDANDVGGGGYGQVYKGTLPN-GQVIAIKRAQQGSMQGAFEFKTEIELLSRVHHKNVVKLLGFCFDQKEQMLVYEYIPNGSLRDGLSG 721          

HSP 2 Score: 73.9442 bits (180), Expect = 1.134e-35
Identity = 33/57 (57.89%), Postives = 44/57 (77.19%), Query Frame = 1
Query:  616 LDWNTRMKIAAGAARGLEYLHDKAKPPVIYRDLKCSNILLDRGYHPKLSDFGLAKLV 786
            LDW  R+KIA G+ +GL YLH+ A PP+I+RD+K +NILLD     K++DFGL+KLV
Sbjct:  727 LDWTRRLKIALGSGKGLAYLHELADPPIIHRDVKSNNILLDEHLTAKVADFGLSKLV 783          
The following BLAST results are available for this feature:
BLAST of EY756166 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 349
Match NameE-valueIdentityDescription
PBS1_ARATH8.016e-5054.27Serine/threonine-protein kinase PBS1 OS=Arabidopsi... [more]
RLCK7_ARATH1.198e-4550.98Probable serine/threonine-protein kinase RLCKVII O... [more]
Y1534_ARATH2.799e-3745.04Probable LRR receptor-like serine/threonine-protei... [more]
Y5374_ARATH3.646e-3748.15Probable LRR receptor-like serine/threonine-protei... [more]
Y1684_ARATH6.188e-3748.51Probable LRR receptor-like serine/threonine-protei... [more]
Y1154_ARATH2.341e-3643.64Probable serine/threonine-protein kinase At1g01540... [more]
BRI1_ARATH3.928e-3646.51Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidops... [more]
Y4245_ARATH8.709e-3643.18Probable LRR receptor-like serine/threonine-protei... [more]
Y5343_ARATH1.133e-3542.03Probable LRR receptor-like serine/threonine-protei... [more]
Y5977_ARATH1.134e-3542.98Probable leucine-rich repeat receptor-like protein... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-D08-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756166 ID=EY756166|Name=EY756166|organism=Citrus sinensis|type=EST|length=890bp
AGCTTGTTGCACTTGGCCTGCTCCTGCTCTTTCCATTGCACCTTCTACAT
CAAGTATCTTTATAAACTCAAGAAGAAAATAAATAGAACATGGGGTGGTT
TCCATGCTCTGGTGATTCATTCAGAAAGGCCAAGAACAAGAAGAAAATGA
AGATGCAACAGAAGACTCTTGATCGGATCAATTCCATTCCAGATAAATTA
AAGATGAATTCCTCCTTGCGGGTCAAGGAGGCATCTGAAGATGGAGCCTC
CGACCAGATTACAGCTCAGACACTAACTTTCCGTGAGTTGGCAGCTGCGA
CTAAAAATTTCAGATCAGAGTCTCTTTTGGGCGAGGGAGGTTTTGGTAGA
GTGTATAAAGGTTATTTAGAAAGTATTAATCAGGTTGTAGCTATCAAGCA
ACTTGATCGCAATGGGGTGCAGGGCAACCGGGAATTTCTTGTTGAAGTAT
TGATGTTAAGTCTACTTCACCACCCTAACCTGGTTAATCTAATCGGTTAT
TGTGCTGATGGCGATCAAAGGCTTTTGGTTTACGAATATATGCCTTTAGG
ATCTGTGGAAGACCATTTACATGGTCTCTTGTCGTTTTGCAGACCTCTCT
CCTGGCAAGAAACCACTTGATTGGAATACAAGAATGAAAATAGCAGCTGG
GGCAGCAAGGGGATTAGAGTATTTACATGACAAAGCTAAACCACCAGTTA
TATACCGAGATTTAAAATGCTCAAACATTTTGCTTGACAGAGGTTATCAT
CCCAAGCTATCTGATTTTGGCTTGGCCAAACTGGTCCTGTTGGTGATACA
CCCATGTATCTACAGGGTTATGGGAACTATGGATACTGTGCTCCAGATAT
GCAAAGACAGCCACTGACTTTAAATCAGATGTGATAGCTT
back to top