EY756113

Overview
NameEY756113
Unique NameEY756113
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length628
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1447 contig Csv1_Contig1447:751..1378. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756113 vs. ExPASy Swiss-Prot
Match: ADK1_ARATH (Adenosine kinase 1 OS=Arabidopsis thaliana GN=ADK1 PE=1 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 6.466e-62
Identity = 111/135 (82.22%), Postives = 125/135 (92.59%), Query Frame = 3
Query:   12 QKALPYMDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 416
            +K LPYMDY+FGNETEARTF++VHGWETD+VE+IA+K+SQ PKASGT+KR TVITQGADPVVVAEDGKVK +PVI LPKEKLVDTNGAGDAFVGGFLSQLV  K +E+CVR GCYA+NVVIQRSGCTYP KP+FN
Sbjct:  210 EKCLPYMDYIFGNETEARTFSRVHGWETDDVEQIAIKMSQLPKASGTYKRTTVITQGADPVVVAEDGKVKKYPVIPLPKEKLVDTNGAGDAFVGGFLSQLVHGKGIEECVRAGCYASNVVIQRSGCTYPEKPDFN 344          
BLAST of EY756113 vs. ExPASy Swiss-Prot
Match: ADK2_ARATH (Adenosine kinase 2 OS=Arabidopsis thaliana GN=ADK2 PE=1 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.457e-61
Identity = 109/135 (80.74%), Postives = 127/135 (94.07%), Query Frame = 3
Query:   12 QKALPYMDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 416
            +K LPYMD+VFGNETEARTF++VHGWET++VE+IA+KISQ PKA+GT+KR TVITQGADPVVVAEDGKVK +PVI LPKEKLVDTNGAGDAFVGGF+SQLV+EK +E+CV+ GCYA+NVVIQRSGCTYP KP+FN
Sbjct:  211 EKFLPYMDFVFGNETEARTFSRVHGWETEDVEQIAIKISQLPKATGTYKRTTVITQGADPVVVAEDGKVKKYPVIPLPKEKLVDTNGAGDAFVGGFMSQLVKEKSIEECVKAGCYASNVVIQRSGCTYPEKPDFN 345          
BLAST of EY756113 vs. ExPASy Swiss-Prot
Match: ADK_PHYPA (Adenosine kinase OS=Physcomitrella patens GN=ADK PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 4.069e-48
Identity = 88/135 (65.19%), Postives = 108/135 (80.00%), Query Frame = 3
Query:    9 LQKALPYMDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEF 413
            L +  PY+D++FGNE+EAR FA+V GWET++ + IA+K++  PKA GTHKR+ VITQG DP +VAEDGKV  FPV  +PKEKLVDTN AGD+FVGGFLSQLV  K +  CVR G YAA+V+IQRSGCT+P KP F
Sbjct:  206 LMELFPYVDFIFGNESEARAFAQVQGWETEDTKVIAVKLAALPKAGGTHKRVAVITQGTDPTIVAEDGKVTEFPVTPIPKEKLVDTNAAGDSFVGGFLSQLVLGKDIAQCVRAGNYAASVIIQRSGCTFPSKPSF 340          
BLAST of EY756113 vs. ExPASy Swiss-Prot
Match: ADK_MOUSE (Adenosine kinase OS=Mus musculus GN=Adk PE=1 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 3.817e-38
Identity = 71/136 (52.21%), Postives = 100/136 (73.53%), Query Frame = 3
Query:    9 LQKALPYMDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 416
            L   +PY+D +FGNETEA TFA+  G+ET +++EIA K    PK +   +R  + TQG D  +VA +  V  FPV+   +E+++DTNGAGDAFVGGFLSQLV +KP+ +C+R G YAA+V+I+R+GCT+P KP+F+
Sbjct:  226 LMDVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKAQALPKVNSKRQRTVIFTQGRDDTIVAAENDVTAFPVLDQNQEEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASVIIRRTGCTFPEKPDFH 361          
BLAST of EY756113 vs. ExPASy Swiss-Prot
Match: ADK_RAT (Adenosine kinase OS=Rattus norvegicus GN=Adk PE=1 SV=3)

HSP 1 Score: 157.147 bits (396), Expect = 6.512e-38
Identity = 72/136 (52.94%), Postives = 99/136 (72.79%), Query Frame = 3
Query:    9 LQKALPYMDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 416
            L + +PY+D +FGNETEA TFA+  G+ET +++EIA K    PK +   +R  + TQG D  +VA    V  FPV+   +E++VDTNGAGDAFVGGFLSQLV  KP+ +C+R G YAA+V+I+R+GCT+P KP+F+
Sbjct:  226 LMEVMPYVDILFGNETEAATFAREQGFETKDIKEIARKTQALPKVNSKRQRTVIFTQGRDDTIVATGNDVTAFPVLDQNQEEIVDTNGAGDAFVGGFLSQLVSNKPLTECIRAGHYAASVIIRRTGCTFPEKPDFH 361          
BLAST of EY756113 vs. ExPASy Swiss-Prot
Match: ADK_HUMAN (Adenosine kinase OS=Homo sapiens GN=ADK PE=1 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 6.512e-38
Identity = 69/137 (50.36%), Postives = 103/137 (75.18%), Query Frame = 3
Query:    6 TLQKALPYMDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 416
            +L K +PY+D +FGNETEA TFA+  G+ET +++EIA K    PK +   +RI + TQG D  ++A + +V  F V+   +++++DTNGAGDAFVGGFLSQLV +KP+ +C+R G YAA+++I+R+GCT+P KP+F+
Sbjct:  226 SLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH 362          
BLAST of EY756113 vs. ExPASy Swiss-Prot
Match: ADK_CRIGR (Adenosine kinase OS=Cricetulus griseus GN=ADK PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 4.666e-36
Identity = 70/137 (51.09%), Postives = 99/137 (72.26%), Query Frame = 3
Query:    6 TLQKALPYMDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYPPKPEFN 416
            +L + +PY+D +FGNETEA TFA+  G+ET +++EIA K     K +    R  V TQG D  VVA + +V  F V+   +++++DTNGAGDAFVGGFLSQLV  KP+ +C+R G YAA+V+I+R+GCT+P KP+F+
Sbjct:  225 SLMEVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKAQALAKVNSKRPRTVVFTQGRDDTVVATENEVMAFAVLDQNQKEIIDTNGAGDAFVGGFLSQLVYNKPLTECIRAGHYAASVIIRRTGCTFPEKPDFH 361          
BLAST of EY756113 vs. ExPASy Swiss-Prot
Match: ADK_SCHPO (Adenosine kinase OS=Schizosaccharomyces pombe GN=ado1 PE=2 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 2.173e-25
Identity = 59/136 (43.38%), Postives = 85/136 (62.50%), Query Frame = 3
Query:    9 LQKALPYMDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYP-PKPEF 413
            +   +PY DYV GNE E  ++ + HG ++ +V+EIAL +S   K +    R+ VITQGAD  +VA+DGKV  +    +P E++VDTNGAGDAF GGF++ L Q + ++  V  G +     I+ SG T P PK +F
Sbjct:  202 MDSVIPYCDYVIGNEAEILSYGENHGIKSTDVQEIALALSSVEKVNKKRTRVVVITQGADATIVAKDGKVTTYKPNRVPSEEIVDTNGAGDAFAGGFIAALSQGQGIDYAVTLGHWLGQECIKVSGTTLPLPKKQF 337          
BLAST of EY756113 vs. ExPASy Swiss-Prot
Match: ADK_SCHCO (Adenosine kinase OS=Schizophyllum commune GN=ADK PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.970e-18
Identity = 51/130 (39.23%), Postives = 75/130 (57.69%), Query Frame = 3
Query:    9 LQKALPYMDYVFGNETEARTFAKVHGWETD-NVEEIALKISQWPKASGTHKRITVITQGADPVVV---AEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSG 386
            +Q+ LPY+D V  NE+EA  +A   G     ++  +A  ++  PK +    R+ + T GA+  VV   AE G+V+ F V  L + ++VDTNGAGDAF GGFL  LV  + ++D V  G   A + IQ+ G
Sbjct:  204 IQQLLPYVDIVIANESEAEAWASASGHPAPTDLAAVAKSLAMQPKTNPARPRVVIFTHGAEETVVVNSAEPGRVRTFKVDKLAEGEIVDTNGAGDAFAGGFLGALVAGRELDDSVEAGHKLAKISIQQIG 333          
BLAST of EY756113 vs. ExPASy Swiss-Prot
Match: ADK_DICDI (Adenosine kinase OS=Dictyostelium discoideum GN=adk PE=3 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 1.970e-18
Identity = 50/138 (36.23%), Postives = 77/138 (55.80%), Query Frame = 3
Query:    9 LQKALPYMDYVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGKVKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTYP---PKPEF 413
            + + LPY+D VF NE+EA T  +   W  D +  IA K++ W K +    R  V TQG D  +V ++G +  +  I +  E ++D N AGD+F GGFL+     + +  CV  G YA+  +I+++G T P   PK +F
Sbjct:  204 VSELLPYVDIVFANESEAATLGRKMNWGED-LTVIAEKLAAWEKVNTKRTRTVVFTQGPDATLVFQNGVLTKYNPIKVATEDILDLNAAGDSFCGGFLAAYSNGQEIAKCVEAGHYASWEIIRQNGATVPASEPKIQF 340          
The following BLAST results are available for this feature:
BLAST of EY756113 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
ADK1_ARATH6.466e-6282.22Adenosine kinase 1 OS=Arabidopsis thaliana GN=ADK1... [more]
ADK2_ARATH2.457e-6180.74Adenosine kinase 2 OS=Arabidopsis thaliana GN=ADK2... [more]
ADK_PHYPA4.069e-4865.19Adenosine kinase OS=Physcomitrella patens GN=ADK P... [more]
ADK_MOUSE3.817e-3852.21Adenosine kinase OS=Mus musculus GN=Adk PE=1 SV=2[more]
ADK_RAT6.512e-3852.94Adenosine kinase OS=Rattus norvegicus GN=Adk PE=1 ... [more]
ADK_HUMAN6.512e-3850.36Adenosine kinase OS=Homo sapiens GN=ADK PE=1 SV=2[more]
ADK_CRIGR4.666e-3651.09Adenosine kinase OS=Cricetulus griseus GN=ADK PE=1... [more]
ADK_SCHPO2.173e-2543.38Adenosine kinase OS=Schizosaccharomyces pombe GN=a... [more]
ADK_SCHCO1.970e-1839.23Adenosine kinase OS=Schizophyllum commune GN=ADK P... [more]
ADK_DICDI1.970e-1836.23Adenosine kinase OS=Dictyostelium discoideum GN=ad... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-G05-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756113 ID=EY756113|Name=EY756113|organism=Citrus sinensis|type=EST|length=628bp
AGGGAACCCTCCAGAAAGCATTACCGTACATGGACTATGTGTTTGGAAAT
GAGACTGAAGCTAGGACCTTCGCAAAGGTTCATGGCTGGGAGACTGACAA
TGTCGAGGAGATTGCTCTGAAGATTTCTCAGTGGCCCAAGGCATCAGGAA
CACACAAGAGGATCACTGTTATCACTCAAGGTGCTGACCCTGTTGTGGTT
GCTGAAGATGGGAAGGTGAAATTATTCCCTGTGATCTTGCTACCCAAGGA
AAAATTGGTTGATACTAATGGAGCAGGGGATGCATTTGTCGGAGGATTTT
TGTCACAGTTGGTTCAAGAGAAGCCAGTGGAAGATTGTGTGAGAACTGGT
TGCTATGCGGCAAATGTTGTAATCCAAAGGTCAGGCTGCACTTACCCCCC
AAAACCTGAATTCAATTAGGCTGATTCCTCATTGCAAGAATCTCTTGCGG
CCTCTGCTATTGTCAGTTTTCTTCCGCTGTTTCTTCATTTTTCGAACTTG
ATTAAAGGGGCCTGTATTATTTAATCTAGGAGTTATTTCAATGTTGAATT
TGTTTGTGATACTCTGTCCACCATGTGGATAAGAATTTGTGACATTTACT
TACAGAGGGAATGCATTTTCCATTTTAA
back to top