EY756099

Overview
NameEY756099
Unique NameEY756099
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length673
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2700 contig Csv1_Contig2700:603..1275. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756099 vs. ExPASy Swiss-Prot
Match: PARP1_MAIZE (Poly [ADP-ribose] polymerase 1 OS=Zea mays GN=PARP1 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 3.122e-36
Identity = 70/81 (86.42%), Postives = 75/81 (92.59%), Query Frame = 3
Query:   12 ELKKAKYMDKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPAPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK 254
            ELKKA  MDKPP GKHSTKGLGKTVP ES+FVKWRDDV VPCGKP PS++R+SELMYNEYIVYNT+QVKMQFLLKVRFHHK
Sbjct:  899 ELKKATSMDKPPRGKHSTKGLGKTVPLESEFVKWRDDVVVPCGKPVPSSIRSSELMYNEYIVYNTSQVKMQFLLKVRFHHK 979          
BLAST of EY756099 vs. ExPASy Swiss-Prot
Match: PARP1_ORYSJ (Poly [ADP-ribose] polymerase 1 OS=Oryza sativa subsp. japonica GN=PARP1 PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.312e-34
Identity = 66/81 (81.48%), Postives = 73/81 (90.12%), Query Frame = 3
Query:   12 ELKKAKYMDKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPAPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK 254
            ELKKA  MDKPP GKHSTKGLGKTVP ES+F KWRDDV VPCGKP P++++ SELMYNEYIVYNT+QVKMQ+LLKVRFHHK
Sbjct:  896 ELKKATSMDKPPRGKHSTKGLGKTVPLESEFAKWRDDVVVPCGKPVPASIKTSELMYNEYIVYNTSQVKMQYLLKVRFHHK 976          
BLAST of EY756099 vs. ExPASy Swiss-Prot
Match: PARP1_ARATH (Poly [ADP-ribose] polymerase 1 OS=Arabidopsis thaliana GN=PARP1 PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 8.501e-34
Identity = 67/81 (82.72%), Postives = 72/81 (88.89%), Query Frame = 3
Query:   12 ELKKAKYMDKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPAPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK 254
            EL KAKYMDKPP GKHSTKGLGK VPQ+S+F KWR DVTVPCGKP  S V+ASELMYNEYIVY+TAQVK+QFLLKVRF HK
Sbjct:  902 ELTKAKYMDKPPRGKHSTKGLGKKVPQDSEFAKWRGDVTVPCGKPVSSKVKASELMYNEYIVYDTAQVKLQFLLKVRFKHK 982          
BLAST of EY756099 vs. ExPASy Swiss-Prot
Match: PARP1_XENLA (Poly [ADP-ribose] polymerase 1 (Fragment) OS=Xenopus laevis GN=parp1 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.038e-15
Identity = 41/81 (50.62%), Postives = 56/81 (69.14%), Query Frame = 3
Query:   12 ELKKAKYMDKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPAPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK 254
            ELK A  + K P GKHS KGLG+T P  S  V+  D V VP GK   +N+  + L+YNEYIVY+ AQV +++LLK++F++K
Sbjct:  914 ELKAASQITKLPKGKHSVKGLGRTAPDPSATVQL-DGVDVPLGKGTSANISDTSLLYNEYIVYDIAQVNLKYLLKLKFNYK 993          
BLAST of EY756099 vs. ExPASy Swiss-Prot
Match: PARP1_RAT (Poly [ADP-ribose] polymerase 1 OS=Rattus norvegicus GN=Parp1 PE=2 SV=4)

HSP 1 Score: 80.8777 bits (198), Expect = 6.767e-15
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   12 ELKKAKYMDKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPAPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK 254
            ELK A ++ K P GKHS KGLGKT P  S  +   D V VP G   PS V  + L+YNEYIVY+ AQV +++LLK++F+ K
Sbjct:  931 ELKHASHISKLPKGKHSVKGLGKTAPDPSASITL-DGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK 1010          
BLAST of EY756099 vs. ExPASy Swiss-Prot
Match: PARP1_MOUSE (Poly [ADP-ribose] polymerase 1 OS=Mus musculus GN=Parp1 PE=1 SV=3)

HSP 1 Score: 80.4925 bits (197), Expect = 8.838e-15
Identity = 41/81 (50.62%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   12 ELKKAKYMDKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPAPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK 254
            ELK A ++ K P GKHS KGLGKT P  S  +   + V VP G   PS V  + L+YNEYIVY+ AQV +++LLK++F+ K
Sbjct:  930 ELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTALLYNEYIVYDIAQVNLKYLLKLKFNFK 1009          
BLAST of EY756099 vs. ExPASy Swiss-Prot
Match: PARP1_HUMAN (Poly [ADP-ribose] polymerase 1 OS=Homo sapiens GN=PARP1 PE=1 SV=4)

HSP 1 Score: 79.337 bits (194), Expect = 1.969e-14
Identity = 41/81 (50.62%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   12 ELKKAKYMDKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPAPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK 254
            ELK A ++ K P GKHS KGLGKT P  S  +   D V VP G    S V  + L+YNEYIVY+ AQV +++LLK++F+ K
Sbjct:  931 ELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK 1010          
BLAST of EY756099 vs. ExPASy Swiss-Prot
Match: PARP1_CRIGR (Poly [ADP-ribose] polymerase 1 OS=Cricetulus griseus GN=PARP1 PE=2 SV=3)

HSP 1 Score: 79.337 bits (194), Expect = 1.969e-14
Identity = 41/81 (50.62%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   12 ELKKAKYMDKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPAPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK 254
            ELK A ++ K P GKHS KGLGKT P  S  +   + V VP G   PS V  + L+YNEYIVY+ AQV +++LLK++F+ K
Sbjct:  930 ELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK 1009          
BLAST of EY756099 vs. ExPASy Swiss-Prot
Match: PARP1_BOVIN (Poly [ADP-ribose] polymerase 1 OS=Bos taurus GN=PARP1 PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 5.729e-14
Identity = 41/81 (50.62%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   12 ELKKAKYMDKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPAPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK 254
            ELK A+++ K P GKHS KGLGKT P  S  +   D V VP G    S V  + L+YNEYIVY+ AQV +++LLK++F+ K
Sbjct:  933 ELKHARHISKLPKGKHSVKGLGKTTPDPSASITV-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK 1012          
BLAST of EY756099 vs. ExPASy Swiss-Prot
Match: PARP2_ARATH (Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thaliana GN=PARP2 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.276e-13
Identity = 35/73 (47.95%), Postives = 48/73 (65.75%), Query Frame = 3
Query:   36 DKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPAPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK 254
            D  P GK STKG+GKT P  S+     D V VP GKP   +     L+YNEYIVYN  Q+KM+++++V+F++K
Sbjct:  564 DNLPPGKLSTKGVGKTAPNPSEAQTLEDGVVVPLGKPVERSCSKGMLLYNEYIVYNVEQIKMRYVIQVKFNYK 636          
The following BLAST results are available for this feature:
BLAST of EY756099 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
PARP1_MAIZE3.122e-3686.42Poly [ADP-ribose] polymerase 1 OS=Zea mays GN=PARP... [more]
PARP1_ORYSJ1.312e-3481.48Poly [ADP-ribose] polymerase 1 OS=Oryza sativa sub... [more]
PARP1_ARATH8.501e-3482.72Poly [ADP-ribose] polymerase 1 OS=Arabidopsis thal... [more]
PARP1_XENLA3.038e-1550.62Poly [ADP-ribose] polymerase 1 (Fragment) OS=Xenop... [more]
PARP1_RAT6.767e-1551.85Poly [ADP-ribose] polymerase 1 OS=Rattus norvegicu... [more]
PARP1_MOUSE8.838e-1550.62Poly [ADP-ribose] polymerase 1 OS=Mus musculus GN=... [more]
PARP1_HUMAN1.969e-1450.62Poly [ADP-ribose] polymerase 1 OS=Homo sapiens GN=... [more]
PARP1_CRIGR1.969e-1450.62Poly [ADP-ribose] polymerase 1 OS=Cricetulus grise... [more]
PARP1_BOVIN5.729e-1450.62Poly [ADP-ribose] polymerase 1 OS=Bos taurus GN=PA... [more]
PARP2_ARATH1.276e-1347.95Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-E11-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756099 ID=EY756099|Name=EY756099|organism=Citrus sinensis|type=EST|length=673bp
CCACGCGTCCGGAGCTCAAGAAGGCGAAGTATATGGATAAACCACCTGAT
GGGAAGCACTCCACTAAAGGACTTGGCAAGACTGTACCACAGGAATCTGA
TTTTGTGAAGTGGAGAGATGATGTCACTGTGCCATGTGGAAAACCAGCAC
CTTCAAATGTCAGGGCTTCTGAGCTGATGTACAATGAATACATTGTTTAT
AATACTGCTCAAGTTAAGATGCAGTTCCTGTTGAAGGTGAGGTTTCATCA
CAAGAGATGAAGGAGGTAACTGGATGCCCACTCTCTTTTGGGAAAGGTCA
TGACTGATTGTCTGAATATCTGAATGTCTTTAATTACCACATGAGAAATT
TTAACTCTTGGATAAGATTGTAAGATCTCATTTTGGGGTTTGCCTGGAGA
TCTTTCAACTGCTGCTTTTGGCTATGTAAATGATGTTGGTAAATGTGTAA
AAAAAGGGTACTTTGGTGTTTCTTAAGCTTTAGTGAGGATGCTATCTTCC
GCCATATCATCTGGCGTTAGCTTTCCTTTTGTTAGATTATGCCAACACAA
TTAGATACACAAAATCCAAGTTTCTTGTACTACATTTGGCAGGATTATTT
CCGGATAAGTGTCCCTGTCAATCAGGTATAAATTTAAGAAACATGCAAAG
ACAGTAATCTTATCTGCCNNNNN
back to top