EY756091

Overview
NameEY756091
Unique NameEY756091
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length532
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2943 contig Csv1_Contig2943:253..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756091 vs. ExPASy Swiss-Prot
Match: CYB52_ARATH (Probable cytochrome b5 isoform 2 OS=Arabidopsis thaliana GN=At2g32720 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 4.158e-56
Identity = 94/104 (90.38%), Postives = 101/104 (97.12%), Query Frame = 2
Query:   80 VYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKS 391
            VY+VTKFLEDHPGGD+VLLS+TGKDATDDFEDVGHS SAREMM+QYYVGEID +TIPKK +YTPPKQPHYNQDKTSEFII+LLQFLVPLAILGLAVGIRIYTKS
Sbjct:   30 VYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSESAREMMEQYYVGEIDPTTIPKKVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAILGLAVGIRIYTKS 133          

HSP 2 Score: 42.3578 bits (98), Expect = 4.158e-56
Identity = 15/23 (65.22%), Postives = 20/23 (86.96%), Query Frame = 1
Query:   13 KVFTLAEVSDHNNMKDCWLIING 81
            K+FTL+EVS+HN   DCW++ING
Sbjct:    6 KIFTLSEVSEHNQAHDCWIVING 28          
BLAST of EY756091 vs. ExPASy Swiss-Prot
Match: CYB5_TOBAC (Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.921e-54
Identity = 86/108 (79.63%), Postives = 96/108 (88.89%), Query Frame = 2
Query:   71 SSMVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKSS 394
            S  VYDVTKFL+DHPGGDEVLLSATGKDATDDFEDVGHS SAR M+D+YYVG+ID +TIP K +YTPP QPHYNQDKTSEF+++LLQFLVPL ILG+A GIR YTK S
Sbjct:   27 SGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSARAMLDEYYVGDIDSATIPTKTKYTPPNQPHYNQDKTSEFVVKLLQFLVPLIILGVAFGIRFYTKQS 134          

HSP 2 Score: 46.595 bits (109), Expect = 4.921e-54
Identity = 19/23 (82.61%), Postives = 21/23 (91.30%), Query Frame = 1
Query:   13 KVFTLAEVSDHNNMKDCWLIING 81
            KVFTLAEVS HNN KDCWL+I+G
Sbjct:    6 KVFTLAEVSQHNNAKDCWLVISG 28          
BLAST of EY756091 vs. ExPASy Swiss-Prot
Match: CYB5S_TOBAC (Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 5.351e-53
Identity = 84/108 (77.78%), Postives = 95/108 (87.96%), Query Frame = 2
Query:   71 SSMVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKSS 394
            S  VY+VTKFLEDHPGG EVLLSATGKDATDDFED+GHS SAR M+D+YYVG+ID STIP K +YTPPKQPHYNQDKT+EFI++LLQFLVPL ILG+A G+  YTK S
Sbjct:   27 SGKVYNVTKFLEDHPGGGEVLLSATGKDATDDFEDIGHSSSARAMLDEYYVGDIDSSTIPTKVKYTPPKQPHYNQDKTTEFIVKLLQFLVPLIILGVAFGVHFYTKQS 134          

HSP 2 Score: 47.3654 bits (111), Expect = 5.351e-53
Identity = 20/23 (86.96%), Postives = 22/23 (95.65%), Query Frame = 1
Query:   13 KVFTLAEVSDHNNMKDCWLIING 81
            KVFTLAEVS+HNN KDCWLII+G
Sbjct:    6 KVFTLAEVSNHNNAKDCWLIISG 28          
BLAST of EY756091 vs. ExPASy Swiss-Prot
Match: CYB5_ORYSJ (Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 8.235e-51
Identity = 85/104 (81.73%), Postives = 96/104 (92.31%), Query Frame = 2
Query:   80 VYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKS 391
            VY+V+KFLEDHPGGD+VLLS+TGKDATDDFEDVGHS +AR MMD+YYVG+ID STIP + +Y PPKQPHYNQDKT EFII++LQFLVPLAILGLAV IRIYTKS
Sbjct:   31 VYNVSKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVAIRIYTKS 134          

HSP 2 Score: 38.5058 bits (88), Expect = 8.235e-51
Identity = 15/24 (62.50%), Postives = 19/24 (79.17%), Query Frame = 1
Query:   10 RKVFTLAEVSDHNNMKDCWLIING 81
            +KV+TL EV+ HN+  DCWLII G
Sbjct:    6 KKVYTLEEVAKHNSKDDCWLIIGG 29          
BLAST of EY756091 vs. ExPASy Swiss-Prot
Match: CYB5_BOROF (Cytochrome b5 OS=Borago officinalis PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 8.247e-51
Identity = 81/105 (77.14%), Postives = 93/105 (88.57%), Query Frame = 2
Query:   80 VYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKSS 394
            VYDVTKFLEDHPGGD+VLLSATGKDATDDFED+GHS SA+ M+D+YYVG+ID S+IP + +YTPPKQP YN DKT EF+I+LLQFLVPL IL  A+GIR YTKSS
Sbjct:   27 VYDVTKFLEDHPGGDDVLLSATGKDATDDFEDIGHSSSAKAMLDEYYVGDIDSSSIPSQVKYTPPKQPLYNPDKTREFVIKLLQFLVPLVILAGAIGIRFYTKSS 131          

HSP 2 Score: 47.3654 bits (111), Expect = 8.247e-51
Identity = 19/23 (82.61%), Postives = 21/23 (91.30%), Query Frame = 1
Query:   13 KVFTLAEVSDHNNMKDCWLIING 81
            K+FTLAEV+ HNN KDCWLIING
Sbjct:    3 KIFTLAEVAQHNNSKDCWLIING 25          
BLAST of EY756091 vs. ExPASy Swiss-Prot
Match: CYB5_CUSRE (Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 9.539e-46
Identity = 80/105 (76.19%), Postives = 89/105 (84.76%), Query Frame = 2
Query:   80 VYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKSS 394
            VYDVTKFL+DHPGG +VLLS+T KDATDDFED+GHS SAR MMD+  VG+ID STIP K  YTPPKQP YNQDKT +FII+LLQFLVPL ILG+AVGIR Y K S
Sbjct:   29 VYDVTKFLDDHPGGADVLLSSTAKDATDDFEDIGHSSSARAMMDEMCVGDIDSSTIPTKTSYTPPKQPLYNQDKTPQFIIKLLQFLVPLIILGVAVGIRFYKKQS 133          

HSP 2 Score: 37.7354 bits (86), Expect = 9.539e-46
Identity = 14/23 (60.87%), Postives = 19/23 (82.61%), Query Frame = 1
Query:   13 KVFTLAEVSDHNNMKDCWLIING 81
            KV++LAEVS+H+   DCWL+I G
Sbjct:    5 KVYSLAEVSEHSQPNDCWLVIGG 27          
BLAST of EY756091 vs. ExPASy Swiss-Prot
Match: CYB51_ARATH (Cytochrome b5 isoform 1 OS=Arabidopsis thaliana GN=At5g53560 PE=2 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 2.290e-44
Identity = 73/106 (68.87%), Postives = 91/106 (85.85%), Query Frame = 2
Query:   71 SSMVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTK 388
            S  VYDVT F++DHPGGDEVLLS+TGKDAT+DFEDVGHS +AR+MMD+Y++GEID S++P  + Y  P+QP YNQDKT EFII++LQFLVP+ ILGLA+ +R YTK
Sbjct:   27 SGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILILGLALVVRHYTK 132          

HSP 2 Score: 38.891 bits (89), Expect = 2.290e-44
Identity = 16/24 (66.67%), Postives = 18/24 (75.00%), Query Frame = 1
Query:   10 RKVFTLAEVSDHNNMKDCWLIING 81
            RKV +  EVS HN  KDCWLII+G
Sbjct:    5 RKVLSFEEVSKHNKTKDCWLIISG 28          
BLAST of EY756091 vs. ExPASy Swiss-Prot
Match: CYB5_BRAOB (Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.462e-43
Identity = 73/106 (68.87%), Postives = 90/106 (84.91%), Query Frame = 2
Query:   71 SSMVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTK 388
            S  VYDVT F++DHPGGDEVLLS+TGKDAT+DFEDVGHS +AR+MM++YY+GEID ST+P  + Y  P QP YNQDKT EF+I++LQFLVP+ ILGLA+ +R YTK
Sbjct:   27 SGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMEKYYIGEIDSSTVPATRTYVAPVQPAYNQDKTPEFMIKILQFLVPILILGLALVVRQYTK 132          

HSP 2 Score: 36.965 bits (84), Expect = 1.462e-43
Identity = 15/24 (62.50%), Postives = 17/24 (70.83%), Query Frame = 1
Query:   10 RKVFTLAEVSDHNNMKDCWLIING 81
            +KV    EVS HN  KDCWLII+G
Sbjct:    5 KKVLGFEEVSQHNKTKDCWLIISG 28          
BLAST of EY756091 vs. ExPASy Swiss-Prot
Match: CYB5_DROME (Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.112e-18
Identity = 38/90 (42.22%), Postives = 59/90 (65.56%), Query Frame = 2
Query:   80 VYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEI---DVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLV 340
            +YDVT FL +HPGG+EVL+   GKDAT++FEDVGHS  AR+MM +Y +GE+   + +++ +K E T   +    +     +++ L+  LV
Sbjct:   31 IYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLV 120          

HSP 2 Score: 31.9574 bits (71), Expect = 1.112e-18
Identity = 13/22 (59.09%), Postives = 16/22 (72.73%), Query Frame = 1
Query:   13 KVFTLAEVSDHNNMKDCWLIIN 78
            K FT AEV+ HN  KD WL+I+
Sbjct:    7 KTFTRAEVAKHNTNKDTWLLIH 28          
BLAST of EY756091 vs. ExPASy Swiss-Prot
Match: CYB5_MUSDO (Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.000e-17
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = 2
Query:   80 VYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEI---DVSTIPKKKEYTPPKQPHYN-QDKTSEFIIRLLQFLVPLAILGL 361
            VYDVT FL +HPGG+EVL+   GKDAT+ FEDVGHS  AREMM QY VGE+   + S +P+K E      P +N + KT E  ++   +L+P  +LGL
Sbjct:   31 VYDVTAFLNEHPGGEEVLIEQAGKDATEHFEDVGHSSDAREMMKQYKVGELVAEERSNVPEKSE------PTWNTEQKTEESSMK--SWLMPF-VLGL 119          

HSP 2 Score: 22.7126 bits (47), Expect = 2.000e-17
Identity = 10/22 (45.45%), Postives = 13/22 (59.09%), Query Frame = 1
Query:   13 KVFTLAEVSDHNNMKDCWLIIN 78
            K FT AEV+ +N     W II+
Sbjct:    7 KYFTRAEVAKNNTKDKNWFIIH 28          
The following BLAST results are available for this feature:
BLAST of EY756091 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
CYB52_ARATH4.158e-5690.38Probable cytochrome b5 isoform 2 OS=Arabidopsis th... [more]
CYB5_TOBAC4.921e-5479.63Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1[more]
CYB5S_TOBAC5.351e-5377.78Cytochrome b5, seed isoform OS=Nicotiana tabacum P... [more]
CYB5_ORYSJ8.235e-5181.73Cytochrome b5 OS=Oryza sativa subsp. japonica GN=O... [more]
CYB5_BOROF8.247e-5177.14Cytochrome b5 OS=Borago officinalis PE=2 SV=1[more]
CYB5_CUSRE9.539e-4676.19Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1[more]
CYB51_ARATH2.290e-4468.87Cytochrome b5 isoform 1 OS=Arabidopsis thaliana GN... [more]
CYB5_BRAOB1.462e-4368.87Cytochrome b5 OS=Brassica oleracea var. botrytis G... [more]
CYB5_DROME1.112e-1842.22Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5... [more]
CYB5_MUSDO2.000e-1751.02Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-E03-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756091 ID=EY756091|Name=EY756091|organism=Citrus sinensis|type=EST|length=532bp
CCACGCGTCCGCAAGGTCTTCACTTTGGCTGAAGTATCTGATCACAACAA
CATGAAAGATTGTTGGCTCATCATCAATGGTGTATGACGTGACAAAATTC
TTGGAAGATCATCCTGGAGGTGATGAAGTTTTGCTGTCTGCAACAGGGAA
GGATGCCACGGATGACTTTGAAGATGTGGGTCATAGTCCGAGTGCCAGAG
AAATGATGGACCAGTACTACGTCGGAGAGATTGATGTATCGACCATCCCA
AAGAAAAAGGAGTATACACCTCCAAAGCAGCCTCACTACAACCAGGACAA
GACATCAGAGTTCATCATCAGGCTTCTCCAATTCCTTGTGCCGCTAGCAA
TCCTGGGGTTGGCCGTCGGCATCCGGATTTATACAAAATCATCTTAATGT
TCTAGACTATGTTCTCATAACAGACAATTTGTGTCATCTTAATGTTCTAG
ATTATGTTATCATAACAGACAATTTGTGTTTTGTTAATGAAACTTTCTTA
GTTCTAANAANAAAANNNAAAAAAAAAAAAAA
back to top