EY756012

Overview
NameEY756012
Unique NameEY756012
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756012 vs. ExPASy Swiss-Prot
Match: PABP2_ARATH (Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 9.261e-49
Identity = 109/218 (50.00%), Postives = 132/218 (60.55%), Query Frame = 3
Query:   12 AVAQRKEERRARLQAQFSQMRPVAMXXXXXXXXXXXXXXXXXLGQQFLYGQAPPAIIP-QAGFGYQQQLVPGMRPAGAPMPNFFXXXXXXXXXXXXXXXXXXXXXXXXTQQPLPIMPHQMPPRGHAYRYPLGRNMQDFPFDMGAGGMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGEKLYPLVEQLERDAAAKVTGMLLEMDR 662
            A+AQRKE+RR RLQAQFSQ+RPVAM                 +GQQ  YGQAPPA+IP Q G+GYQQQLVPGMRP G P+P+FF                        +QQ  P+M  QM PRG  +RYP GR         G  G +P P DMG  +P         + I AL++ L+NA+PEQQRT+LGE LYPLVEQ+E ++AAKVTGMLLEMD+
Sbjct:  391 AIAQRKEDRRVRLQAQFSQVRPVAMQPSVGPRMPVYPPGGPGIGQQMFYGQAPPAMIPPQPGYGYQQQLVPGMRPGGGPVPSFFMPMVQPQQQRPGGGRRPGGIQH--SQQQNPMMQQQMHPRGRMFRYPQGR---------GGSGDVP-PYDMGNNMP---------LTIGALASNLSNATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLLEMDQ 587          

HSP 2 Score: 27.335 bits (59), Expect = 9.261e-49
Identity = 14/16 (87.50%), Postives = 14/16 (87.50%), Query Frame = 1
Query:  691 EALXAKVAEAMXVLRS 738
            EAL AKVAEAM VLRS
Sbjct:  598 EALKAKVAEAMDVLRS 613          

HSP 3 Score: 20.7866 bits (42), Expect = 9.261e-49
Identity = 9/10 (90.00%), Postives = 9/10 (90.00%), Query Frame = 2
Query:  659 QTEVLHLSES 688
            QTEVLHL ES
Sbjct:  587 QTEVLHLLES 596          
BLAST of EY756012 vs. ExPASy Swiss-Prot
Match: PABP3_ARATH (Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 9.906e-20
Identity = 80/225 (35.56%), Postives = 109/225 (48.44%), Query Frame = 3
Query:   12 AVAQRKEERRARLQAQFSQMR-PVAMXXXXXXXXXXXXXXXXXLGQQFLYGQAPPAIIPQA--GFGYQQQLVPGMRPAGAPMPNFFXXXXXXXXXXXXXXXXXXXXXXXXTQ--QPLPIMPHQMPPRGHAYRYPL--GRNMQDFPFDMGA-GGMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGEKLYPLVEQLERDAAAKVTGMLLEMDR 662
            A+AQRKE+RRA LQA FSQ+R P  M                   Q    GQ   +++P    G+G+Q Q +PGMRP   P  NF                          Q  Q   +M H+ P  G  Y      GRN  D     G    ++P+P+D  + I  + A +   +PI+ L+++LA+ASP  +  +LGE+LYPLVE+ E    AKVTGMLLEMD+
Sbjct:  405 ALAQRKEDRRAHLQALFSQIRAPGPMSGFHHPPGGPMPGPP----QHMYVGQNGASMVPSQPIGYGFQPQFMPGMRPGSGP-GNFIVPYPLQRQPQTGPRMGFRRGATNVQQHIQQQQLM-HRNPSPGMRYMNGASNGRNGMDSSVPQGILPPIIPLPID-ASSISHQKAPL---LPISKLTSSLASASPADRTRMLGEQLYPLVERHEPLHVAKVTGMLLEMDQ 619          

HSP 2 Score: 22.3274 bits (46), Expect = 9.906e-20
Identity = 10/15 (66.67%), Postives = 13/15 (86.67%), Query Frame = 1
Query:  691 EALXAKVAEAMXVLR 735
            EAL +KV+EA+ VLR
Sbjct:  630 EALKSKVSEALDVLR 644          
BLAST of EY756012 vs. ExPASy Swiss-Prot
Match: PABP5_ARATH (Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 4.790e-19
Identity = 75/228 (32.89%), Postives = 104/228 (45.61%), Query Frame = 3
Query:   12 AVAQRKEERRARLQAQFSQMR------PVAMXXXXXXXXXXXXXXXXXLGQQFLYGQAPPAIIPQA--GFGYQQQLVPGMRPAGAPMPNFFXXXXXXXXXXXXXXXXXXXXXXXXTQQPLPIMPHQMPPRGHAYRYPLGRNMQDFPFDMGAG-GMLPVPVDMGAGIPRRDASVGQPMPITA--LSTALANASPEQQRTLLGEKLYPLVEQLERDAAAKVTGMLLEMDR 662
            A+AQRKEER+A LQ+ F+Q+R      PV                       F+ G     ++P    G+GYQ Q +PGMRP   P PNF                          QQ       Q   + +A R+  G   +    +  A  G++P+P++  A          +P P+T   L++ LA ASP++   +LG+ LYPLVEQ E   AAKVTGMLLEMD+
Sbjct:  401 ALAQRKEERQAHLQSLFTQIRSPGTMSPVPSPMSGFHHHPPGGPMSGPHHPMFI-GHNGQGLVPSQPMGYGYQVQFMPGMRPGAGP-PNFMMPFPLQRQTQPGPRVGFRRGANNMQQQ----FQQQQMLQQNASRFMGGAGNRRNGMEASAPQGIIPLPLNASANSHNAPQRSHKPTPLTISKLASDLALASPDKHPRMLGDHLYPLVEQQEPANAAKVTGMLLEMDQ 622          

HSP 2 Score: 23.483 bits (49), Expect = 4.790e-19
Identity = 11/15 (73.33%), Postives = 13/15 (86.67%), Query Frame = 1
Query:  691 EALXAKVAEAMXVLR 735
            EAL AKV+EA+ VLR
Sbjct:  633 EALKAKVSEALDVLR 647          
BLAST of EY756012 vs. ExPASy Swiss-Prot
Match: PABP_CRYNE (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans GN=PAB1 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.202e-11
Identity = 71/238 (29.83%), Postives = 91/238 (38.24%), Query Frame = 3
Query:   12 AVAQRKEERRARLQAQFSQMRPVAMXXXXXXXXXXXXXXXXXLGQQFLYGQAPPAIIPQAGFGYQQQLVPGMRPAGAPMPNFFXXXXXXXXXXXXXXXXXXXXXXXXTQQPLPI------MPHQMPPRGHAYRYPLGRNMQDFPFDMGAGGML---PVPVDMGAGIPRRDASVGQPMPITALSTA-------------LANASPEQQRTLLGEKLYPLVEQLERDAAAKVTGMLLEMD 659
            A+AQRK+ RR  L++Q +Q     M                  G Q   GQ      P  G+G   Q +PGM P   PM  +                           QPLP       MP Q+P  G A  YP+       P    A G     P PV    G+P      G  MP      A             LA A+P +Q+ +LGE LYPL+ + + + A K+TGMLLEMD
Sbjct:  403 ALAQRKDVRRQALESQIAQRAQQRMQYGAGFP-----------GMQGYMGQPMYGYPPMPGYG---QPMPGMPPVRGPMMGY---------PGAPQNMMQSRPRFNPNGQPLPGGVPAYGMPPQVPYPG-APGYPVRPGGARIPAAPNANGPRNGGPSPVGAPQGLPAGSIPRGGQMPARPHEQAAPAPQAGRLDAQSLARAAPAEQKQMLGEALYPLIHETQPELAGKITGMLLEMD 616          
The following BLAST results are available for this feature:
BLAST of EY756012 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
PABP2_ARATH9.261e-4950.00Polyadenylate-binding protein 2 OS=Arabidopsis tha... [more]
PABP3_ARATH9.906e-2035.56Polyadenylate-binding protein 3 OS=Arabidopsis tha... [more]
PABP5_ARATH4.790e-1932.89Polyadenylate-binding protein 5 OS=Arabidopsis tha... [more]
PABP_CRYNE1.202e-1129.83Polyadenylate-binding protein, cytoplasmic and nuc... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-F02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756012 ID=EY756012|Name=EY756012|organism=Citrus sinensis|type=EST|length=931bp
CCACGCGTCCGGCTGTTGCTCAGCGGAAAGAAGAGAGGAGGGCCAGGCTG
CAGGCTCAGTTTTCACAAATGAGACCAGTAGCTATGGGTCCCTCGGTTCC
TCCTCGTATGCCAATGTACCCACCTGGCCCTTCAGGCCTAGGGCAACAGT
TTCTGTATGGCCAAGCACCACCAGCAATAATTCCTCAAGCTGGATTTGGT
TACCAGCAGCAACTTGTTCCTGGAATGAGGCCTGCTGGGGCACCGATGCC
GAACTTCTTTGTTCCAGTGGTCTCGCAAGGTCAGCAGGGCCAGCGTCCTG
GTGGACGACGTGGTGCTGGACCTGTGCAACAGACCCAGCAGCCACTCCCC
ATTATGCCGCACCAGATGCCTCCCAGGGGTCATGCCTATCGGTACCCACT
TGGCCGTAATATGCAAGATTTCCCCTTTGACATGGGTGCTGGCGGTATGC
TCCCTGTTCCCGTTGACATGGGCGCTGGCATACCTCGGCGAGATGCATCT
GTTGGACAACCTATGCCGATAACGGCTTTGTCTACTGCTCTTGCAAATGC
ATCACCAGAACAGCAAAGGACGCTGCTGGGTGAAAAGTTATATCCTCTAG
TGGAGCAGCTGGAGCGAGATGCAGCGGCTAAGGTAACGGGAATGCTCTTG
GAGATGGACAGACAGAGGTTTTGCATCTTTCTGAGTCACAGAAGCTTTGA
ANGCAAAAGTAGCTGAGGCAATGGNAGTTTTGAGGAGTGGTGCTCAGCAG
CAGGCTAATATCCAGCAGATCAACTGGCTTCATGTCCCTGGATGAAAACC
TTGNTTCTGAGCCGCGTGCTGGCATTGAAAAAGTTTGATTAGTGGGGGTT
CAAACAATAAGCCTTTGTTTTTGCATGGATGGGTAAGGGTTGGGTAATTT
AATCCGGAAATCTGGAAGATCTGCCCGCCCA
back to top