EY756011

Overview
NameEY756011
Unique NameEY756011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length437
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756011 vs. ExPASy Swiss-Prot
Match: E6_GOSHI (Protein E6 OS=Gossypium hirsutum GN=E6 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 5.149e-13
Identity = 35/75 (46.67%), Postives = 52/75 (69.33%), Query Frame = 1
Query:   16 EKLGMSDTRFLENGKYYYDVQNENNNFPAGFESEKGTTTSRGYYGNTQNVNEFSTMEQF-ENQQEYQGSPEEYVP 237
            EK GMSDTR+LENGKYYYDV++ENN +P  F++ +G  +      N  N N ++ M ++ +NQ+E++ S EE+ P
Sbjct:  169 EKQGMSDTRYLENGKYYYDVKSENNYYPNRFDNSRGVASR-----NEFNENRYNNMGRYHQNQEEFEESEEEFEP 238          
The following BLAST results are available for this feature:
BLAST of EY756011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
E6_GOSHI5.149e-1346.67Protein E6 OS=Gossypium hirsutum GN=E6 PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-F01-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756011 ID=EY756011|Name=EY756011|organism=Citrus sinensis|type=EST|length=437bp
CCACGCGTCCGGAATGAGAAGCTAGGGATGAGTGACACAAGATTTTTGGA
GAATGGTAAGTACTACTATGATGTCCAGAATGAGAACAATAATTTTCCTG
CCGGGTTTGAATCTGAGAAGGGAACTACTACAAGTAGAGGTTACTATGGA
AATACACAGAATGTAAATGAGTTCAGCACCATGGAACAATTTGAGAACCA
GCAGGAGTACCAAGGGAGCCCTGAGGAGTACGTGCCTTGAACATTAGTCA
TGATTGTAAAACAGAGAAAAAAGAATGAAAGTGGAAAAATTTGGGAGTGT
CACTAGAAAGAAGATTAAATTATGTGAATGTTTATTCACATCATAGTTTT
AAANAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAANNNNNNNNANAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAANANNNNNNN
back to top