EY756007

Overview
NameEY756007
Unique NameEY756007
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length631
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5089 contig Csv1_Contig5089:161..791. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756007 vs. ExPASy Swiss-Prot
Match: PSAH_BRARA (Photosystem I reaction center subunit VI, chloroplastic OS=Brassica rapa GN=PSAH PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.256e-46
Identity = 93/126 (73.81%), Postives = 103/126 (81.75%), Query Frame = 3
Query:   45 MASLATIAAVQP-ATIKGLGGSSLAGTKLTVKPTRQSFRPKSFKAGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRXXXXXXXXXXXXSTLAYFSATASGDI 419
            MAS ATIAAVQP + +KGLGGSSL G KL +KP+RQSF+PKS +AGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYN LQSKFFETFAAPFTKR            S L Y SA+++GD+
Sbjct:    1 MASFATIAAVQPYSAVKGLGGSSLTGAKLFIKPSRQSFKPKSTRAGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSASSTGDV 126          
BLAST of EY756007 vs. ExPASy Swiss-Prot
Match: PSAH2_ARATH (Photosystem I reaction center subunit VI-2, chloroplastic OS=Arabidopsis thaliana GN=PSAH2 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 8.573e-46
Identity = 93/126 (73.81%), Postives = 102/126 (80.95%), Query Frame = 3
Query:   45 MASLATIAAVQP-ATIKGLGGSSLAGTKLTVKPTRQSFRPKSFKAGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRXXXXXXXXXXXXSTLAYFSATASGDI 419
            MAS ATIAAVQP A +KGLGGSSLAG KL +KP+RQSF+ KS +AGAVVAKYGDKSVYFDLEDLGNTTGQWD+YGSDAPSPYN LQSKFFETFAAPFTKR            S L Y SA ++GD+
Sbjct:    1 MASFATIAAVQPSAAVKGLGGSSLAGAKLFIKPSRQSFKTKSTRAGAVVAKYGDKSVYFDLEDLGNTTGQWDVYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANSTGDV 126          
BLAST of EY756007 vs. ExPASy Swiss-Prot
Match: PSAH1_ARATH (Photosystem I reaction center subunit VI-1, chloroplastic OS=Arabidopsis thaliana GN=PSAH1 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.910e-45
Identity = 91/126 (72.22%), Postives = 103/126 (81.75%), Query Frame = 3
Query:   45 MASLATIAAVQP-ATIKGLGGSSLAGTKLTVKPTRQSFRPKSFKAGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRXXXXXXXXXXXXSTLAYFSATASGDI 419
            MASLAT+AAV+P A IKGLGGSSLAG KL++KP+R SF+PKS +A  VVAKYGDKSVYFDLEDLGNTTGQWD+YGSDAPSPYN LQSKFFETFAAPFTKR            S L Y SAT++G++
Sbjct:    1 MASLATVAAVKPSAAIKGLGGSSLAGAKLSIKPSRLSFKPKSIRANGVVAKYGDKSVYFDLEDLGNTTGQWDVYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSATSTGEV 126          
BLAST of EY756007 vs. ExPASy Swiss-Prot
Match: PSAH_SPIOL (Photosystem I reaction center subunit VI, chloroplastic OS=Spinacia oleracea GN=PSAH PE=1 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.758e-44
Identity = 87/125 (69.60%), Postives = 99/125 (79.20%), Query Frame = 3
Query:   45 MASLATIAAVQPATIKGLGGSSLAGTKLTVKPTRQSFRPKSFKAGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRXXXXXXXXXXXXSTLAYFSATASGDI 419
            MASLAT+AAVQP T+KGL GSS+AGTKL +KP RQSF+  + ++GA+VAKYGDKSVYFDLED+ NTTGQWD+YGSDAPSPYNSLQSKFFETFAAPFTKR            S L Y SA A  D+
Sbjct:    1 MASLATLAAVQPTTLKGLAGSSIAGTKLHIKPARQSFKLNNVRSGAIVAKYGDKSVYFDLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDV 125          
BLAST of EY756007 vs. ExPASy Swiss-Prot
Match: PSAH_MAIZE (Photosystem I reaction center subunit VI, chloroplastic OS=Zea mays GN=PSAH PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.116e-36
Identity = 82/126 (65.08%), Postives = 95/126 (75.40%), Query Frame = 3
Query:   45 MASLATIAAVQPATIKGLGGSSLAGTKLTV-KPTRQSFRPKSFKAGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRXXXXXXXXXXXXSTLAYFSATASGDI 419
            MASLA ++ V+P  IKGL GSS++G KL V +P+ +S R    +A AVVAKYGDKSVYFDL+D+GNTTGQWDLYGSDAPSPYN LQSKFFETFAAPFTKR            S LAY SA+AS D+
Sbjct:    1 MASLAAVS-VKPVAIKGLAGSSISGRKLAVARPSARSIRRP--RAAAVVAKYGDKSVYFDLDDIGNTTGQWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLLLGGGSLLAYVSASASPDL 123          
BLAST of EY756007 vs. ExPASy Swiss-Prot
Match: PSAH_ORYSJ (Photosystem I reaction center subunit VI, chloroplastic OS=Oryza sativa subsp. japonica GN=PSAH PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.050e-35
Identity = 77/127 (60.63%), Postives = 93/127 (73.23%), Query Frame = 3
Query:   54 LATIAAVQPATIKGLGGSSLAGTKLTVKPT-----RQSFRPKSFKAGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRXXXXXXXXXXXXSTLAYFSATASGDI 419
            +A++ AVQP  +KGL GSS++G KL V+P+     R + RP++    AVVAKYG+KSVYFDLED+GNTTGQWDLYGSDAPSPYN LQSKFFETFA PFTKR            S +AY SA+AS D+
Sbjct:    1 MASLVAVQPVAVKGLAGSSISGRKLAVRPSPRALCRTTRRPRA----AVVAKYGEKSVYFDLEDIGNTTGQWDLYGSDAPSPYNPLQSKFFETFAGPFTKRGLLLKFLLLGGGSLVAYVSASASPDL 123          
BLAST of EY756007 vs. ExPASy Swiss-Prot
Match: PSAH_ORYSI (Photosystem I reaction center subunit VI, chloroplastic OS=Oryza sativa subsp. indica GN=PSAH PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.050e-35
Identity = 77/127 (60.63%), Postives = 93/127 (73.23%), Query Frame = 3
Query:   54 LATIAAVQPATIKGLGGSSLAGTKLTVKPT-----RQSFRPKSFKAGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRXXXXXXXXXXXXSTLAYFSATASGDI 419
            +A++ AVQP  +KGL GSS++G KL V+P+     R + RP++    AVVAKYG+KSVYFDLED+GNTTGQWDLYGSDAPSPYN LQSKFFETFA PFTKR            S +AY SA+AS D+
Sbjct:    1 MASLVAVQPVAVKGLAGSSISGRKLAVRPSPRALCRTTRRPRA----AVVAKYGEKSVYFDLEDIGNTTGQWDLYGSDAPSPYNPLQSKFFETFAGPFTKRGLLLKFLLLGGGSLVAYVSASASPDL 123          
BLAST of EY756007 vs. ExPASy Swiss-Prot
Match: PSAH_HORVU (Photosystem I reaction center subunit VI, chloroplastic OS=Hordeum vulgare GN=PSAH PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 3.992e-35
Identity = 74/124 (59.68%), Postives = 91/124 (73.39%), Query Frame = 3
Query:   54 LATIAAVQPATIKGLGGSSLAGTKLTVKPTRQSFRPKSFKA--GAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRXXXXXXXXXXXXSTLAYFSATASGDI 419
            +A++ AVQPA +KGL GSS++G KL V+P+  +    + +A   AVVAKYG+KSVYFDL+D+ NTTGQWDLYGSDAPSPYN LQSKFF TFAAPFTKR            S +AY SA+AS D+
Sbjct:    1 MASLVAVQPAAVKGLSGSSISGRKLAVRPSSAAVSRSTRRARGAAVVAKYGEKSVYFDLDDIANTTGQWDLYGSDAPSPYNGLQSKFFNTFAAPFTKRGLLLKFLLIGGGSLVAYVSASASPDL 124          
BLAST of EY756007 vs. ExPASy Swiss-Prot
Match: PSAH_PEA (Photosystem I reaction center subunit VI (Fragment) OS=Pisum sativum GN=PSAH PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 8.653e-14
Identity = 33/36 (91.67%), Postives = 35/36 (97.22%), Query Frame = 3
Query:  192 KYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQ 299
            KYGDKSVYFDLED+GNTTGQWDLYGSDAPSPY+ LQ
Sbjct:    1 KYGDKSVYFDLEDIGNTTGQWDLYGSDAPSPYSXLQ 36          
The following BLAST results are available for this feature:
BLAST of EY756007 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
PSAH_BRARA2.256e-4673.81Photosystem I reaction center subunit VI, chloropl... [more]
PSAH2_ARATH8.573e-4673.81Photosystem I reaction center subunit VI-2, chloro... [more]
PSAH1_ARATH1.910e-4572.22Photosystem I reaction center subunit VI-1, chloro... [more]
PSAH_SPIOL2.758e-4469.60Photosystem I reaction center subunit VI, chloropl... [more]
PSAH_MAIZE2.116e-3665.08Photosystem I reaction center subunit VI, chloropl... [more]
PSAH_ORYSJ1.050e-3560.63Photosystem I reaction center subunit VI, chloropl... [more]
PSAH_ORYSI1.050e-3560.63Photosystem I reaction center subunit VI, chloropl... [more]
PSAH_HORVU3.992e-3559.68Photosystem I reaction center subunit VI, chloropl... [more]
PSAH_PEA8.653e-1491.67Photosystem I reaction center subunit VI (Fragment... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-E08-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756007 ID=EY756007|Name=EY756007|organism=Citrus sinensis|type=EST|length=631bp
CCACGCGTCCGTAAGCAAGTCACAATTTACAACAAACCAAGGCCATGGCA
TCTCTTGCAACCATAGCTGCTGTGCAACCAGCCACCATCAAAGGCCTTGG
AGGCAGCTCTCTTGCTGGAACTAAGCTCACCGTCAAGCCAACTCGCCAGA
GTTTCAGACCCAAAAGCTTCAAGGCTGGTGCTGTTGTGGCTAAGTATGGT
GATAAGAGTGTGTACTTTGATTTGGAGGATTTGGGCAACACTACGGGCCA
GTGGGACTTGTACGGATCAGATGCTCCTTCACCGTACAACTCTCTTCAGA
GCAAGTTCTTTGAGACATTTGCGGCTCCATTCACCAAGAGAGGATTATTG
CTCAAGTTCTTGATATTGGGAGGAGGTTCAACCCTTGCTTACTTCAGTGC
TACAGCTAGTGGTGACATTCTCCCAATCAAGAAGGGCCCTCAACTTCCAC
CAAAGCTCGGACCACGTGGCAAGATCTAAATTAGTTTTCAATCCTCATAT
TTTTAACTTTTCATTGTATGTATCTTCTTGTTATTGTAAACCTGTAGGTT
TGTCCAACATCCTACTTAAGACTTCCTTTGTTATTAATGCCAATATATTT
GCTTCAATTGAAAAAAAAAAAAAAAAAAAAA
back to top