EY755999

Overview
NameEY755999
Unique NameEY755999
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length914
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY755999 vs. ExPASy Swiss-Prot
Match: CCD1_PHAVU (Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Phaseolus vulgaris GN=CCD1 PE=1 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 1.843e-139
Identity = 214/235 (91.06%), Postives = 224/235 (95.32%), Query Frame = 2
Query:   14 PTKDLHVIGHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAKFMKIGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAVKVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGYAHTPPYITYRVISKDGFMHDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVK 718
            PTKDL V GHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFV TSRLKQEE+FG +KFMKIGDLKGLFGLLMVN+ MLR KLKVLD+SYG GT NTALVYHHGKLLALSEADKPYA+KV EDGDLQTLGMLDYDKRL HSFTAHPKVDP+TGEMF+FGYAHTPPYITYRVISKDG+MHDPVPIT+SDPIMMHDFAITENYA+FMDLPL FRPKEMVK
Sbjct:   63 PTKDLPVKGHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVETSRLKQEEYFGRSKFMKIGDLKGLFGLLMVNIHMLRTKLKVLDLSYGGGTTNTALVYHHGKLLALSEADKPYAIKVFEDGDLQTLGMLDYDKRLGHSFTAHPKVDPFTGEMFSFGYAHTPPYITYRVISKDGYMHDPVPITISDPIMMHDFAITENYAVFMDLPLIFRPKEMVK 297          

HSP 2 Score: 64.6994 bits (156), Expect = 1.843e-139
Identity = 30/58 (51.72%), Postives = 39/58 (67.24%), Query Frame = 1
Query:  691 VFQTKGNGERNKLIFTFDDTKKARXGILPRYAKNEAXNEWXELPNAYL-HKGHAWGEE 861
            +F+ K   +   LIF+FD TKKAR G+LPRYAK+E    W ELPN ++ H  +AW EE
Sbjct:  289 IFRPKEMVKNKTLIFSFDSTKKARFGVLPRYAKDEQHIRWFELPNCFIFHNANAWEEE 346          
BLAST of EY755999 vs. ExPASy Swiss-Prot
Match: CCD1_PEA (Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Pisum sativum GN=CCD1 PE=2 SV=1)

HSP 1 Score: 447.973 bits (1151), Expect = 4.936e-137
Identity = 209/235 (88.94%), Postives = 224/235 (95.32%), Query Frame = 2
Query:   14 PTKDLHVIGHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAKFMKIGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAVKVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGYAHTPPYITYRVISKDGFMHDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVK 718
            P KDL V GHLPDCLNGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKA+YVSRFV+TSR KQEE+F G+KFMKIGDLKGLFGLLMVNMQMLRAKLK+LDVSYG+GTANTALVYHH KLLALSE DKPYA+KV EDGDLQTLGMLDYDKRL H+FTAHPKVDP+TGEMFTFGY+HT PY+TYRVISKDGFM DPVPIT+SDP+MMHDFAITENY+IFMDLPLYFRPKEMVK
Sbjct:   61 PVKDLTVQGHLPDCLNGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKASYVSRFVKTSRFKQEEYFNGSKFMKIGDLKGLFGLLMVNMQMLRAKLKILDVSYGHGTANTALVYHHQKLLALSEGDKPYAIKVFEDGDLQTLGMLDYDKRLGHNFTAHPKVDPFTGEMFTFGYSHTAPYVTYRVISKDGFMQDPVPITISDPVMMHDFAITENYSIFMDLPLYFRPKEMVK 295          

HSP 2 Score: 62.3882 bits (150), Expect = 4.936e-137
Identity = 29/57 (50.88%), Postives = 38/57 (66.67%), Query Frame = 1
Query:  694 FQTKGNGERNKLIFTFDDTKKARXGILPRYAKNEAXNEWXELPNAYL-HKGHAWGEE 861
            F+ K   +   LIF+FD TKKAR G+LPRYAK++    W ELPN ++ H  +AW EE
Sbjct:  288 FRPKEMVKNKTLIFSFDSTKKARFGVLPRYAKDDKHIRWFELPNCFIFHNANAWEEE 344          
BLAST of EY755999 vs. ExPASy Swiss-Prot
Match: CCD1_ARATH (Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Arabidopsis thaliana GN=CCD1 PE=1 SV=2)

HSP 1 Score: 434.491 bits (1116), Expect = 2.470e-133
Identity = 203/236 (86.02%), Postives = 219/236 (92.80%), Query Frame = 2
Query:   14 PTKDLHVIGHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAKFMKIGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAVKVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGYAHTPPYITYRVISKDGFMHDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVKE 721
            P KDL V G LP+CLNGEFVRVGPNPKF  VAGYHWFDGDGMIHG+RIKDGKATYVSR+V+TSRLKQEEFFG AKFMKIGDLKG FGLLMVN+Q LR KLK+LD +YGNGTANTALVYHHGKLLAL EADKPY +KVLEDGDLQTLG++DYDKRL HSFTAHPKVDP TGEMFTFGY+HTPPY+TYRVISKDG MHDPVPIT+S+PIMMHDFAITE YAIFMDLP++FRPKEMVKE
Sbjct:   61 PVKDLPVHGFLPECLNGEFVRVGPNPKFDAVAGYHWFDGDGMIHGVRIKDGKATYVSRYVKTSRLKQEEFFGAAKFMKIGDLKGFFGLLMVNVQQLRTKLKILDNTYGNGTANTALVYHHGKLLALQEADKPYVIKVLEDGDLQTLGIIDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHTPPYLTYRVISKDGIMHDPVPITISEPIMMHDFAITETYAIFMDLPMHFRPKEMVKE 296          

HSP 2 Score: 63.5438 bits (153), Expect = 2.470e-133
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 1
Query:  694 FQTKGNGERNKLIFTFDDTKKARXGILPRYAKNEAXNEWXELPNAYL-HKGHAWGEE 861
            F+ K   +  K+I++FD TKKAR G+LPRYAK+E    W ELPN ++ H  +AW EE
Sbjct:  288 FRPKEMVKEKKMIYSFDPTKKARFGVLPRYAKDELMIRWFELPNCFIFHNANAWEEE 344          
BLAST of EY755999 vs. ExPASy Swiss-Prot
Match: CCD_CROSA (Carotenoid 9,10(9',10')-cleavage dioxygenase OS=Crocus sativus GN=CCD PE=1 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 1.126e-130
Identity = 199/235 (84.68%), Postives = 214/235 (91.06%), Query Frame = 2
Query:   14 PTKDLHVIGHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAKFMKIGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAVKVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGYAHTPPYITYRVISKDGFMHDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVK 718
            P  DL V GHLP+CLNGEFVRVGPNPKF PVAGYHWFDGDGMIHG+RIKDGKATY SR+V+TSRLKQEE+F G KFMKIGDLKG FGL MV MQ+LRAKLKV+DVSYG GT NTAL+YHHGKLLALSEADKPY VKVLEDGDLQTLG+LDYDKRL HSFTAHPKVDP+T EMFTFGYAHTPPY+TYRVISKDG M DPVPIT+   +MMHDFAITENY+IFMDLPLYF+PKEMVK
Sbjct:   65 PCPDLPVRGHLPECLNGEFVRVGPNPKFMPVAGYHWFDGDGMIHGMRIKDGKATYASRYVKTSRLKQEEYFEGPKFMKIGDLKGFFGLFMVQMQLLRAKLKVIDVSYGVGTGNTALIYHHGKLLALSEADKPYVVKVLEDGDLQTLGLLDYDKRLSHSFTAHPKVDPFTDEMFTFGYAHTPPYVTYRVISKDGVMRDPVPITIPASVMMHDFAITENYSIFMDLPLYFQPKEMVK 299          

HSP 2 Score: 63.5438 bits (153), Expect = 1.126e-130
Identity = 30/56 (53.57%), Postives = 39/56 (69.64%), Query Frame = 1
Query:  694 FQTKGNGERNKLIFTFDDTKKARXGILPRYAKNEAXNEWXELPNAYL-HKGHAWGE 858
            FQ K   +  KLIF+FD TKKAR G+LPRYAK+++   W ELPN ++ H  +AW E
Sbjct:  292 FQPKEMVKGGKLIFSFDATKKARFGVLPRYAKDDSLIRWFELPNCFIFHNANAWEE 347          
BLAST of EY755999 vs. ExPASy Swiss-Prot
Match: NCED3_ARATH (9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic OS=Arabidopsis thaliana GN=NCED3 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 5.477e-56
Identity = 102/235 (43.40%), Postives = 147/235 (62.55%), Query Frame = 2
Query:   20 KDLHVIGHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAKFMK-IGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAVKVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGY-AHTPPYITYRVISKDGFMHDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVK 718
            ++L V+G LPD + G +VR G NP   PV G+H+FDGDGM+H ++ + G A+Y  RF +T+R  QE   G   F K IG+L G  G+  + +   RA   ++D ++G G AN  LVY +G+LLA+SE D PY V++  +GDL+T+G  D+D +L+ +  AHPKVDP +GE+F   Y   + PY+ Y   S DG     V I +  P MMHDFAITEN+ +  D  + F+  EM++
Sbjct:  137 RNLPVVGKLPDSIKGVYVRNGANPLHEPVTGHHFFDGDGMVHAVKFEHGSASYACRFTQTNRFVQERQLGRPVFPKAIGELHGHTGIARLMLFYARAAAGIVDPAHGTGVANAGLVYFNGRLLAMSEDDLPYQVQITPNGDLKTVGRFDFDGQLESTMIAHPKVDPESGELFALSYDVVSKPYLKYFRFSPDGTKSPDVEIQLDQPTMMHDFAITENFVVVPDQQVVFKLPEMIR 371          

HSP 2 Score: 34.6538 bits (78), Expect = 5.477e-56
Identity = 15/41 (36.59%), Postives = 25/41 (60.98%), Query Frame = 1
Query:  739 FDDTKKARXGILPRYAKNEAXNEWXELPNAY-LHKGHAWGE 858
            +D  K AR GIL +YA++ +  +W + P+ +  H  +AW E
Sbjct:  378 YDKNKVARFGILDKYAEDSSNIKWIDAPDCFCFHLWNAWEE 418          
BLAST of EY755999 vs. ExPASy Swiss-Prot
Match: NCED1_MAIZE (9-cis-epoxycarotenoid dioxygenase 1, chloroplastic OS=Zea mays GN=VP14 PE=1 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 3.811e-54
Identity = 107/238 (44.96%), Postives = 146/238 (61.34%), Query Frame = 2
Query:   14 PTKDLHVIGHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKA-TYVSRFVRTSRLKQEEFFGGAKFMK-IGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAVKVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGY-AHTPPYITYRVISKDGFMHDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVK 718
            P  +L V G +P  ++G + R G NP F PVAG+H FDGDGM+H LRI++G A +Y  RF  T+RL+QE   G   F K IG+L G  G+  + +   RA   ++D S G G AN  LVY +G+LLA+SE D PY V+V +DGDL+T+G  D+D +L  +  AHPK+DP TGE+    Y     PY+ Y     DG   D V I +  P M+HDFAITEN  +  D  + F+ +EM++
Sbjct:  135 PVHELPVSGRIPPFIDGVYARNGANPCFDPVAGHHLFDGDGMVHALRIRNGAAESYACRFTETARLRQERAIGRPVFPKAIGELHGHSGIARLALFYARAACGLVDPSAGTGVANAGLVYFNGRLLAMSEDDLPYHVRVADDGDLETVGRYDFDGQLGCAMIAHPKLDPATGELHALSYDVIKRPYLKYFYFRPDGTKSDDVEIPLEQPTMIHDFAITENLVVVPDHQVVFKLQEMLR 372          

HSP 2 Score: 33.113 bits (74), Expect = 3.811e-54
Identity = 13/41 (31.71%), Postives = 25/41 (60.98%), Query Frame = 1
Query:  742 DDTKKARXGILPRYAKNEAXNEWXELPNAY-LHKGHAWGEE 861
            D  K +R G+LP++A + +   W ++P+ +  H  +AW +E
Sbjct:  380 DKEKTSRFGVLPKHAADASEMAWVDVPDCFCFHLWNAWEDE 420          
BLAST of EY755999 vs. ExPASy Swiss-Prot
Match: NCED5_ARATH (Probable 9-cis-epoxycarotenoid dioxygenase NCED5, chloroplastic OS=Arabidopsis thaliana GN=NCED5 PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.101e-53
Identity = 101/231 (43.72%), Postives = 141/231 (61.04%), Query Frame = 2
Query:   26 LHVIGHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAKFMK-IGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAVKVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGY-AHTPPYITYRVISKDGFMHDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEM 712
            L V G +PDC++G ++R G NP F PV+G+H FDGDGM+H ++I +G A+Y  RF  T RL QE+  G   F K IG+L G  G+  + +   R    +L+   G G AN  LVY H +LLA+SE D PY V+V ++GDL+T+G  D+D +L  +  AHPK+DP T E+F   Y     PY+ Y   S +G     V I ++ P MMHDFAITEN+ +  D  + F+  +M
Sbjct:  129 LSVDGKIPDCIDGVYLRNGANPLFEPVSGHHLFDGDGMVHAVKITNGDASYSCRFTETERLVQEKQLGSPIFPKAIGELHGHSGIARLMLFYARGLFGLLNHKNGTGVANAGLVYFHDRLLAMSEDDLPYQVRVTDNGDLETIGRFDFDGQLSSAMIAHPKIDPVTKELFALSYDVVKKPYLKYFKFSPEGEKSPDVEIPLASPTMMHDFAITENFVVIPDQQVVFKLSDM 359          

HSP 2 Score: 33.113 bits (74), Expect = 1.101e-53
Identity = 16/39 (41.03%), Postives = 22/39 (56.41%), Query Frame = 1
Query:  739 FDDTKKARXGILPRYAKNEAXNEWXELPNAY-LHKGHAW 852
            +D  K +R GILPR AK+ +   W E P  +  H  +AW
Sbjct:  368 YDGEKISRFGILPRNAKDASEMVWVESPETFCFHLWNAW 406          
BLAST of EY755999 vs. ExPASy Swiss-Prot
Match: NCED9_ARATH (9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic OS=Arabidopsis thaliana GN=NCED9 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 7.035e-53
Identity = 101/234 (43.16%), Postives = 140/234 (59.83%), Query Frame = 2
Query:   23 DLHVIGHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAKFMK-IGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAVKVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGY-AHTPPYITYRVISKDGFMHDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVK 718
            +L V G +P+C+ G +VR G NP   PV+G+H FDGDGM+H +R  +G  +Y  RF  T+RL QE   G   F K IG+L G  G+  + +   R    ++D + G G AN  LVY +G LLA+SE D PY VKV + GDL+T G  D+D +L+ +  AHPK+DP T E+F   Y   + PY+ Y   + DG     V I +  P M+HDFAITEN+ +  D  + FR  EM++
Sbjct:  198 NLPVTGTVPECIQGVYVRNGANPLHKPVSGHHLFDGDGMVHAVRFDNGSVSYACRFTETNRLVQERECGRPVFPKAIGELHGHLGIAKLMLFNTRGLFGLVDPTGGLGVANAGLVYFNGHLLAMSEDDLPYHVKVTQTGDLETSGRYDFDGQLKSTMIAHPKIDPETRELFALSYDVVSKPYLKYFRFTSDGEKSPDVEIPLDQPTMIHDFAITENFVVIPDQQVVFRLPEMIR 431          

HSP 2 Score: 35.4242 bits (80), Expect = 7.035e-53
Identity = 15/41 (36.59%), Postives = 27/41 (65.85%), Query Frame = 1
Query:  739 FDDTKKARXGILPRYAKNEAXNEWXELPNAY-LHKGHAWGE 858
            +D+ KK+R GIL + AK+ +  +W E+P+ +  H  ++W E
Sbjct:  438 YDEKKKSRFGILNKNAKDASSIQWIEVPDCFCFHLWNSWEE 478          
BLAST of EY755999 vs. ExPASy Swiss-Prot
Match: NCED1_PHAVU (9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic OS=Phaseolus vulgaris GN=NCED1 PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 5.868e-52
Identity = 99/237 (41.77%), Postives = 144/237 (60.76%), Query Frame = 2
Query:   11 APTKDLHVIGHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAKFMK-IGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAVKVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGY-AHTPPYITYRVISKDGFMHDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMV 715
            A  + L V+G +P C++G +VR G NP + PVAG+H+FDGDGM+H ++  +G A+Y  RF  T RL QE+  G   F K IG+L G  G+  + +   R+  +++D S+G G AN  LVY +  LLA+SE D PY V++  +GDL T+G  D++ +L  +  AHPK+DP  G++    Y     PY+ Y   S DG     V I + +P MMHDFAITEN+ +  D  + F+  EM+
Sbjct:  153 AADQALPVVGKIPKCIDGVYVRNGANPLYEPVAGHHFFDGDGMVHAVKFTNGAASYACRFTETQRLAQEKSLGRPVFPKAIGELHGHSGIARLLLFYARSLFQLVDGSHGMGVANAGLVYFNNHLLAMSEDDLPYHVRITSNGDLTTVGRYDFNGQLNSTMIAHPKLDPVNGDLHALSYDVVQKPYLKYFRFSADGVKSPDVEIPLKEPTMMHDFAITENFVVVPDQQVVFKLTEMI 389          

HSP 2 Score: 30.0314 bits (66), Expect = 5.868e-52
Identity = 14/41 (34.15%), Postives = 21/41 (51.22%), Query Frame = 1
Query:  739 FDDTKKARXGILPRYAKNEAXNEWXELPNAY-LHKGHAWGE 858
            +D  K +R GIL + AK+     W + P  +  H  +AW E
Sbjct:  397 YDKNKTSRFGILDKNAKDANAMRWIDAPECFCFHLWNAWEE 437          
BLAST of EY755999 vs. ExPASy Swiss-Prot
Match: NCED2_ARATH (9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic OS=Arabidopsis thaliana GN=NCED2 PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 1.841e-50
Identity = 100/242 (41.32%), Postives = 145/242 (59.92%), Query Frame = 2
Query:    8 SAPTKDLHVIGHLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAKFMK-IGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAVKVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGY-AHTPPYITYRVISKDGFMHDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVKETS 727
            S+  ++L V G +PDC++G ++R G NP F P AG+H FDGDGM+H ++I +G A+Y  RF +T RL QE+  G   F K IG+L G  G+  + +   R    +++   G G AN  LVY + +LLA+SE D PY +K+ + GDLQT+G  D+D +L+ +  AHPK+DP T E+    Y     PY+ Y   S DG     + I +  P M+HDFAITEN+ +  D  + F+  EM+   S
Sbjct:  116 SSVRRNLTVEGTIPDCIDGVYIRNGANPMFEPTAGHHLFDGDGMVHAVKITNGSASYACRFTKTERLVQEKRLGRPVFPKAIGELHGHSGIARLMLFYARGLCGLINNQNGVGVANAGLVYFNNRLLAMSEDDLPYQLKITQTGDLQTVGRYDFDGQLKSAMIAHPKLDPVTKELHALSYDVVKKPYLKYFRFSPDGVKSPELEIPLETPTMIHDFAITENFVVIPDQQVVFKLGEMISGKS 357          

HSP 2 Score: 26.9498 bits (58), Expect = 1.841e-50
Identity = 13/39 (33.33%), Postives = 19/39 (48.72%), Query Frame = 1
Query:  739 FDDTKKARXGILPRYAKNEAXNEWXELPNAY-LHKGHAW 852
            FD  K +R GI+P+ A   +   W   P  +  H  +AW
Sbjct:  361 FDGEKVSRLGIMPKDATEASQIIWVNSPETFCFHLWNAW 399          
The following BLAST results are available for this feature:
BLAST of EY755999 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
CCD1_PHAVU1.843e-13991.06Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=... [more]
CCD1_PEA4.936e-13788.94Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=... [more]
CCD1_ARATH2.470e-13386.02Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=... [more]
CCD_CROSA1.126e-13084.68Carotenoid 9,10(9',10')-cleavage dioxygenase OS=Cr... [more]
NCED3_ARATH5.477e-5643.409-cis-epoxycarotenoid dioxygenase NCED3, chloropla... [more]
NCED1_MAIZE3.811e-5444.969-cis-epoxycarotenoid dioxygenase 1, chloroplastic... [more]
NCED5_ARATH1.101e-5343.72Probable 9-cis-epoxycarotenoid dioxygenase NCED5, ... [more]
NCED9_ARATH7.035e-5343.169-cis-epoxycarotenoid dioxygenase NCED9, chloropla... [more]
NCED1_PHAVU5.868e-5241.779-cis-epoxycarotenoid dioxygenase NCED1, chloropla... [more]
NCED2_ARATH1.841e-5041.329-cis-epoxycarotenoid dioxygenase NCED2, chloropla... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-D11-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755999 ID=EY755999|Name=EY755999|organism=Citrus sinensis|type=EST|length=914bp
CCACGCGTCCGCTCCTACTAAAGACCTCCACGTCATCGGCCATCTCCCCG
ATTGCTTGAATGGGGAGTTTGTCAGGGTTGGTCCTAATCCCAAGTTTGCC
CCTGTGGCCGGATACCACTGGTTTGATGGAGATGGCATGATTCATGGTCT
GCGCATCAAAGACGGAAAGGCTACATATGTCTCCCGTTTTGTGAGGACTT
CACGTCTTAAACAGGAAGAATTTTTCGGAGGTGCTAAATTTATGAAGATT
GGAGACCTTAAGGGGCTATTTGGATTACTCATGGTTAACATGCAAATGCT
TAGAGCAAAGTTGAAAGTACTGGATGTTTCATATGGAAATGGGACAGCTA
ATACAGCTCTTGTATATCACCATGGGAAACTTCTAGCGCTCTCAGAGGCG
GACAAACCATATGCCGTCAAAGTTCTGGAAGATGGAGATCTGCAAACACT
TGGTATGCTTGACTATGACAAGAGATTACAACATTCCTTTACTGCCCATC
CAAAGGTTGATCCATACACTGGCGAGATGTTTACCTTTGGCTATGCACAC
ACACCACCATATATCACATACAGAGTTATTTCAAAGGATGGTTTCATGCA
TGATCCTGTACCAATAACCGTATCAGACCCCATCATGATGCACGACTTTG
CTATTACTGAGAATTATGCTATTTTCATGGATCTTCCGCTGTATTTCAGA
CCAAAGGAAATGGTGAAAGAAACAAGCTGATATTCACATTTGATGATACA
AAGAAAGCTCGNNTTGGTATACTTCCCCGATATGCAAAGAATGAGGCTCN
NAATGAATGGNTTGAGCTTCCTAATGCTTATCTTCATAAAGGCCATGCTT
GGGGAGAGGAGATGAAGTGGTCTGATCACTTGCGGCTAGACAGCCGATCT
GACCATGGCATGGG
back to top