EY755996

Overview
NameEY755996
Unique NameEY755996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length626
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY755996 vs. ExPASy Swiss-Prot
Match: DRL24_ARATH (Probable disease resistance protein At4g14610 OS=Arabidopsis thaliana GN=At4g14610 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.838e-25
Identity = 71/147 (48.30%), Postives = 90/147 (61.22%), Query Frame = 2
Query:   56 CFQSLRVVVIDLCIGLKDLTFLVFASNLKSIEVRSCFAMEDIISVGKFADFPEVMAN-LNPFAKLQYLQLAGLPNLKSIYWKPLPFSHLKEMSV-FNCDKLKKLPLD--SNTAKECKLVICGEPDWWKELRWEDKPTQDAFLPCFKS 484
            CF SL  VVI  C GLK+LT+L+FA NL  ++ R    +EDIIS  K A   +  A+ + PF KL+ L L+ LP LKSIYW PL F  L E++V  +C KLKKLPL+  S TA    +V  GE  W + + WEDK T+  FL   KS
Sbjct:  570 CFSSLSKVVIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNSKSGTAGVELVVKYGENKWLEGVEWEDKATELRFLATCKS 716          
BLAST of EY755996 vs. ExPASy Swiss-Prot
Match: DRL2_ARATH (Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 4.840e-25
Identity = 68/146 (46.58%), Postives = 91/146 (62.33%), Query Frame = 2
Query:   56 CFQSLRVVVIDLCIGLKDLTFLVFASNLKSIEVRSCFAMEDIISVGKFADFPEVMANLNPFAKLQYLQLAGLPNLKSIYWKPLPFSHLKEMSVFN-CDKLKKLPLDSNT---AKECKLVICGEPDWWKELRWEDKPTQDAFLPCFK 481
            CF +L  V+I  C GLKDLT+L+FA NL  + V +   +E+IIS  K +      A++ PF KL+YL L  LP LKSIYW PLPF  L +++V N C KL KLPLDS +   A E  ++  G+ +W + + WEDK T+  FLP  K
Sbjct:  738 CFPNLSKVLITGCNGLKDLTWLLFAPNLTHLNVWNSRQIEEIISQEKAST-----ADIVPFRKLEYLHLWDLPELKSIYWNPLPFPCLNQINVQNKCRKLTKLPLDSQSCIVAGEELVIQYGDEEWKERVEWEDKATRLRFLPSCK 878          
BLAST of EY755996 vs. ExPASy Swiss-Prot
Match: DRL31_ARATH (Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.722e-22
Identity = 61/140 (43.57%), Postives = 88/140 (62.86%), Query Frame = 2
Query:   59 FQSLRVVVIDLCIGLKDLTFLVFASNLKSIEVRSCFAMEDIISVGKFADFPEV--MANLNPFAKLQYLQLAGLPNLKSIYWKPLPFSHLKEMSVFNCDKLKKLPLDSNTAKECKLVICGEPDWWKELRWEDKPTQDAFLP 472
            F +LR V +D C GLKDLT+LVFA +L ++ V     +E IIS  + +   +   +A + PF +L++L L  L  LKSIY  PL F  LKE+++ +C KL KLPLDS +A +  +VI  E +W + L+WED  T++ F P
Sbjct:  734 FINLRKVRLDNCTGLKDLTWLVFAPHLATLYVVCLPDIEHIISRSEESRLQKTCELAGVIPFRELEFLTLRNLGQLKSIYRDPLLFGKLKEINIKSCPKLTKLPLDSRSAWKQNVVINAEEEWLQGLQWEDVATKERFFP 873          
BLAST of EY755996 vs. ExPASy Swiss-Prot
Match: RFL1_ARATH (Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=2 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 2.936e-22
Identity = 63/141 (44.68%), Postives = 84/141 (59.57%), Query Frame = 2
Query:   59 FQSLRVVVIDLCIGLKDLTFLVFASNLKSIEVRSCFAMEDIISVGKFADFPEVMANLNPFAKLQYLQLAGLPNLKSIYWKPLPFSHLKEMSVF-NCDKLKKLPLDSNTAKECK--LVICGEPDWWKELRWEDKPTQDAFLP 472
            F +L  V I+ C GLKDLT+L+FA NL ++ V  C  +EDIIS  K A   E    + PF KL+ L L  L  LKSIYW  LPF  L+ + +  NC KL+KLPLDS +  + +  ++   E  W + + WED+ TQ  FLP
Sbjct:  742 FSNLSNVRIEGCDGLKDLTWLLFAPNLINLRVWGCKHLEDIISKEKAASVLE--KEILPFQKLECLNLYQLSELKSIYWNALPFQRLRCLDILNNCPKLRKLPLDSKSVVKVEEFVIKYKEKKWIERVEWEDEATQYRFLP 880          
BLAST of EY755996 vs. ExPASy Swiss-Prot
Match: RPS5_ARATH (Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 8.544e-22
Identity = 66/141 (46.81%), Postives = 83/141 (58.87%), Query Frame = 2
Query:   56 CFQSLRVVVIDLCIGLKDLTFLVFASNLKSIEVRSCFAMEDIISVGKFADFPEVMANLNPFAKLQYLQLAGLPNLKSIYWKPLPFSHLKEMSVFNCDKLKKLPLDSNT--AKECKLVICGEPDWWKELRWEDKPTQDAFLP 472
            CF +L  V I  C GLKDLT+L+FA NL  +EV     +EDIIS  K     E  A + PF KL+ L L  L  LK IY K L F  LK + V  C+KL+KLPLDS +  A E  ++  GE +W + + WED+ TQ  FLP
Sbjct:  743 CFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKAE---EHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLP 880          
BLAST of EY755996 vs. ExPASy Swiss-Prot
Match: DRL1_ARATH (Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.457e-21
Identity = 62/143 (43.36%), Postives = 88/143 (61.54%), Query Frame = 2
Query:   65 SLRVVVIDLCIGLKDLTFLVFASNLKSIEVRSCFAMEDIISVGKFADFPEVMANLNPFAKLQYLQLAGLPNLKSIYWKPLPFSHLKEMSVFNCDKLKKLPLDSNTA-KECKLVI-CGEPDWWKELRWEDKPTQDAFLPCFKSF 487
            +L  V I  C GLKDLT+L+FA NL S+EV     +E II+  K       M+ + PF KL+ L+L  L  L+SIYW+PL F  LK + +  C +L+KLPLDS  A ++ +LVI   E +W + + W+++ T+  FLP FK F
Sbjct:  746 NLSTVHISSCDGLKDLTWLLFAPNLTSLEVLDSELVEGIINQEKAM----TMSGIIPFQKLESLRLHNLAMLRSIYWQPLSFPCLKTIHITKCPELRKLPLDSEIAIRDEELVIKYQEEEWLERVEWDNEATRLRFLPFFKFF 884          
BLAST of EY755996 vs. ExPASy Swiss-Prot
Match: DRL20_ARATH (Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.903e-21
Identity = 56/141 (39.72%), Postives = 87/141 (61.70%), Query Frame = 2
Query:   59 FQSLRVVVIDLCIGLKDLTFLVFASNLKSIEVRSCFAMEDIISVGKFADFPEVMANLNPFAKLQYLQLAGLPNLKSIYWKPLPFSHLKEMSVFNCDKLKKLPLDSNTAKECK---LVICGEPDWWKELRWEDKPTQDAFLP 472
            F SL  V I  C GL++LTFL+FA  ++S+ V     +EDII+  K  +  E  + + PF +L +L L  LP LK IYW+PLPF  L+E+++  C  L+KLPLDS + K+ +   ++   +  W++ ++W D+ T+  FLP
Sbjct:  738 FLSLVDVNIFNCEGLRELTFLIFAPKIRSLSVWHAKDLEDIINEEKACEGEE--SGILPFPELNFLTLHDLPKLKKIYWRPLPFLCLEEINIRECPNLRKLPLDSTSGKQGENGCIIRNKDSRWFEGVKWADEATKKRFLP 876          
BLAST of EY755996 vs. ExPASy Swiss-Prot
Match: DRL19_ARATH (Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 4.240e-21
Identity = 61/146 (41.78%), Postives = 83/146 (56.85%), Query Frame = 2
Query:   59 FQSLRVVVIDLCIGLKDLTFLVFASNLKSIEVRSCFAMEDIISVGKFADFPEVMANLNPFAKLQYLQLAGLPNLKSIYWKPLPFSHLKEMSVFNCDKLKKLPLDSNTAK---ECKLVICGEPDWWKELRWEDKPTQDAFLPCFKSF 487
            F SL  V +  C  L++LTFL+FA NLK + V S   +EDII+  K  D  +  + + PF KL  L L  L  LK+IYW PLPF  L++++V  C  LKKLPLDS + K      ++   E +W   + WED+ T+  FL    SF
Sbjct:  734 FSSLIEVNLSNCRRLRELTFLMFAPNLKRLHVVSSNQLEDIINKEKAHDGEK--SGIVPFPKLNELHLYNLRELKNIYWSPLPFPCLEKINVMGCPNLKKLPLDSKSGKHGGNGLIITHREMEWITRVEWEDEATKTRFLANRSSF 877          
BLAST of EY755996 vs. ExPASy Swiss-Prot
Match: DRL15_ARATH (Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 4.240e-21
Identity = 56/147 (38.10%), Postives = 86/147 (58.50%), Query Frame = 2
Query:   56 CFQSLRVVVIDLCIGLKDLTFLVFASNLKSIEVRSCFAMEDIISVGKFADFPEVMANLNPFAKLQYLQLAGLPNLKSIYWKPLPFSHLKEMSVFNCDKLKKLPLDSNT---AKECKLVICGEPDWWKELRWEDKPTQDAFLPCFKSF 487
            CF +L  + I  C  +KDLT+++FA NL  + +     + +II+  K  +    + ++ PF KL++L L  LP L+SIYW PLPF  L  M V NC KL+KLPL++ +    +E ++ +   P+   EL WED  T++ FLP  K +
Sbjct:  734 CFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEKATN----LTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLNATSVSKVEEFEIHMYPPPEQENELEWEDDDTKNRFLPSIKPY 876          
BLAST of EY755996 vs. ExPASy Swiss-Prot
Match: DRL16_ARATH (Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 5.538e-21
Identity = 56/144 (38.89%), Postives = 85/144 (59.03%), Query Frame = 2
Query:   56 CFQSLRVVVIDLCIGLKDLTFLVFASNLKSIEVRSCFAMEDIISVGKFADFPEVMANLNPFAKLQYLQLAGLPNLKSIYWKPLPFSHLKEMSVFNCDKLKKLPLDSNTAK--ECKLVICGEPDWWKELRWEDKPTQDAFLPCFK 481
            CF +L  ++I  C  +KDLT+++FA NL ++++R    + +II+  K  +   +   + PF KL+ L L GLP L+SIYW PLPF  L  + V  C KL+KLPL++ +    E   +    P+   EL WED+ T++ FLP  K
Sbjct:  740 CFTNLTGLIIMKCHSMKDLTWILFAPNLVNLDIRDSREVGEIINKEKAINLTSI---ITPFQKLERLFLYGLPKLESIYWSPLPFPLLSNIVVKYCPKLRKLPLNATSVPLVEEFEIRMDPPEQENELEWEDEDTKNRFLPSIK 880          
The following BLAST results are available for this feature:
BLAST of EY755996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
DRL24_ARATH2.838e-2548.30Probable disease resistance protein At4g14610 OS=A... [more]
DRL2_ARATH4.840e-2546.58Probable disease resistance protein At1g12290 OS=A... [more]
DRL31_ARATH1.722e-2243.57Putative disease resistance protein At5g05400 OS=A... [more]
RFL1_ARATH2.936e-2244.68Disease resistance protein RFL1 OS=Arabidopsis tha... [more]
RPS5_ARATH8.544e-2246.81Disease resistance protein RPS5 OS=Arabidopsis tha... [more]
DRL1_ARATH1.457e-2143.36Probable disease resistance protein At1g12280 OS=A... [more]
DRL20_ARATH1.903e-2139.72Probable disease resistance protein At1g63360 OS=A... [more]
DRL19_ARATH4.240e-2141.78Putative disease resistance protein At1g63350 OS=A... [more]
DRL15_ARATH4.240e-2138.10Probable disease resistance protein At1g61180 OS=A... [more]
DRL16_ARATH5.538e-2138.89Probable disease resistance protein At1g61190 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-D07-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755996 ID=EY755996|Name=EY755996|organism=Citrus sinensis|type=EST|length=626bp
CCACGCGTCCGTGGTAGAATTGCAGATTGATTATAAAGGGGAAGCACAAC
AGTTTTGTTTCCAAAGCCTTCGCGTGGTTGTAATAGACCTTTGCATAGGA
TTGAAGGACTTGACATTCCTTGTTTTTGCTTCGAACCTCAAGTCTATTGA
AGTAAGAAGTTGTTTTGCCATGGAAGACATCATAAGTGTGGGAAAATTTG
CTGATTTTCCAGAAGTGATGGCAAATCTAAACCCTTTTGCAAAACTCCAA
TATCTTCAATTAGCTGGTCTGCCAAATCTGAAGAGCATTTACTGGAAGCC
CCTGCCCTTCTCACATTTGAAAGAAATGAGTGTATTTAATTGCGATAAGC
TTAAAAAGCTTCCACTTGACTCCAATACTGCGAAGGAGTGTAAACTTGTT
ATTTGTGGAGAACCAGACTGGTGGAAAGAGCTTCGATGGGAGGACAAACC
AACTCAAGATGCTTTTCTTCCCTGTTTCAAATCTTTTTGAGTGGAGTTTT
TTAATTCCTGAGCAGTGAATATTGTATTTGATTTCTGGTGTGATGCCTGC
TTTTCCTTGCATTCTTCTTGTTAATTCCTTTCATGTGAAAAAGGTTCTGT
TTCTTAAAAAANAAANAAANAAANAA
back to top