EY755995

Overview
NameEY755995
Unique NameEY755995
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length571
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6061 contig Csv1_Contig6061:83..653. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755995 vs. ExPASy Swiss-Prot
Match: AGT21_ARATH (Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana GN=AGT2 PE=1 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.524e-59
Identity = 112/148 (75.68%), Postives = 127/148 (85.81%), Query Frame = 1
Query:   13 GAVATTPEIANVMAQKIQFNTFGGNPVCSAGGLAVLRVIDKERRQAHCADVGSHLLGRLRTLQERHDIIGDVRGRGLMVGMELVTDRKEKTPAKAETAVLFEKLREXXXXXXXXXXXXXXFRIKPPMCFTKDDADFLVDALDYSMSKL 456
            GAV TTPEIA+V+A KI FNTFGGNPVCSAGGLAVL VIDKE+RQ HCA+VGSHL+ RL+ +Q+RHDIIGDVRGRGLMVG+ELV+DRK+KTPAKAET+VLFE+LRE              FRIKPPMCFTKDDADFLVDALDYS+S+L
Sbjct:  329 GAVVTTPEIASVLASKILFNTFGGNPVCSAGGLAVLNVIDKEKRQEHCAEVGSHLIQRLKDVQKRHDIIGDVRGRGLMVGIELVSDRKDKTPAKAETSVLFEQLRELGILVGKGGLHGNVFRIKPPMCFTKDDADFLVDALDYSISRL 476          
BLAST of EY755995 vs. ExPASy Swiss-Prot
Match: AGT22_ARATH (Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial OS=Arabidopsis thaliana GN=AGT3 PE=2 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 1.258e-42
Identity = 86/148 (58.11%), Postives = 110/148 (74.32%), Query Frame = 1
Query:   13 GAVATTPEIANVMAQKIQFNTFGGNPVCSAGGLAVLRVIDKERRQAHCADVGSHLLGRLRTLQERHDIIGDVRGRGLMVGMELVTDRKEKTPAKAETAVLFEKLREXXXXXXXXXXXXXXFRIKPPMCFTKDDADFLVDALDYSMSKL 456
            GAV TTPEIA V+ ++  FNTFGGN V +  GLAVL VI+KE+ Q + A VGS+L  +L  L+E+H+IIGDVRGRGLM+G+ELV+DRK KTPA AET  + ++++E              FRI PP+CFTKDDADFLV+A+DYSMSK+
Sbjct:  330 GAVVTTPEIAGVLTRRSYFNTFGGNSVSTTAGLAVLNVIEKEKLQENAAMVGSYLKEKLTQLKEKHEIIGDVRGRGLMLGVELVSDRKLKTPATAETLHIMDQMKELGVLIGKGGYFGNVFRITPPLCFTKDDADFLVEAMDYSMSKM 477          
BLAST of EY755995 vs. ExPASy Swiss-Prot
Match: AGT23_ARATH (Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial OS=Arabidopsis thaliana GN=At3g08860 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.701e-39
Identity = 80/148 (54.05%), Postives = 106/148 (71.62%), Query Frame = 1
Query:   13 GAVATTPEIANVMAQKIQFNTFGGNPVCSAGGLAVLRVIDKERRQAHCADVGSHLLGRLRTLQERHDIIGDVRGRGLMVGMELVTDRKEKTPAKAETAVLFEKLREXXXXXXXXXXXXXXFRIKPPMCFTKDDADFLVDALDYSMSKL 456
            GAV TTPEIA V++++  FNTFGGNP+C+A G AVLRV+ +E+ Q +   VGSHL  RL  L+ ++++IGDVRGRGLM+G+E V DR  KTPAKAET  L ++++E              FRI PP+CFT  DADFLVD +D++MSK+
Sbjct:  334 GAVVTTPEIAGVLSRRSYFNTFGGNPMCTAAGHAVLRVLHEEKLQENANLVGSHLKRRLTLLKNKYELIGDVRGRGLMLGVEFVKDRDLKTPAKAETLHLMDQMKEMGVLVGKGGFYGNVFRITPPLCFTLSDADFLVDVMDHAMSKM 481          
BLAST of EY755995 vs. ExPASy Swiss-Prot
Match: AT2L1_MOUSE (Alanine--glyoxylate aminotransferase 2-like 1 OS=Mus musculus GN=Agxt2l1 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 3.327e-27
Identity = 70/170 (41.18%), Postives = 100/170 (58.82%), Query Frame = 1
Query:   19 VATTPEIANVMAQKIQ--FNTFGGNPVCSAGGLAVLRVIDKERRQAHCADVGSHLLGRLRTLQERHDIIGDVRGRGLMVGMELVTDRKEKTPAKAETAVLFEKLREXXXXXXXXXXXXXXFRIKPPMCFTKDDADFLVDALDYSMSKL*R*ICYKLGKIM*HFKSSEYRT 522
            V TT EIA   +      FNT+GGNPV  A GLAVL VI+KE  Q +   VG++L+  L   + +H +IGD+RG GL +G++LV DR+++TPA AE   +  +++                +IKPPMCFT+DDA FLVD LD  ++ L   +  K G +    +++ YRT
Sbjct:  289 VVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDVIEKENLQGNAVRVGTYLMELLSEQKAKHPLIGDIRGVGLFIGIDLVKDREKRTPATAEAQHIIYEMKGKGVLLSADGPHRNVLKIKPPMCFTEDDAKFLVDHLDGILTVLEEAMDSKSGTVF--SENTAYRT 456          
BLAST of EY755995 vs. ExPASy Swiss-Prot
Match: AT2L1_DANRE (Alanine--glyoxylate aminotransferase 2-like 1 OS=Danio rerio GN=agxt2l1 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 5.675e-27
Identity = 65/148 (43.92%), Postives = 94/148 (63.51%), Query Frame = 1
Query:   19 VATTPEIA-NVMAQKIQ-FNTFGGNPVCSAGGLAVLRVIDKERRQAHCADVGSHLLGRLRTLQERHDIIGDVRGRGLMVGMELVTDRKEKTPAKAETAVLFEKLREXXXXXXXXXXXXXXFRIKPPMCFTKDDADFLVDALDYSMSKL 456
            V T+ EIA + M+  ++ FNTFGGNPV  A GLAVL VI+KE  Q +   VG +L   L  L++RH ++GDVRGRGL VG+ELV ++ ++TPA AE   +  +L+E               + KPPMCF+++DA+F V+ +D  ++ L
Sbjct:  291 VITSREIAESFMSSGMEYFNTFGGNPVSCAIGLAVLNVIEKEDLQGNALHVGGYLTQLLEDLKKRHPLVGDVRGRGLFVGLELVRNQSKRTPATAEAQEVIYRLKEQRILLSADGPHRNVLKFKPPMCFSREDAEFAVEKIDQILTDL 438          
BLAST of EY755995 vs. ExPASy Swiss-Prot
Match: AT2L1_HUMAN (Alanine--glyoxylate aminotransferase 2-like 1 OS=Homo sapiens GN=AGXT2L1 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.070e-25
Identity = 62/148 (41.89%), Postives = 88/148 (59.46%), Query Frame = 1
Query:   19 VATTPEIANVMAQKIQ--FNTFGGNPVCSAGGLAVLRVIDKERRQAHCADVGSHLLGRLRTLQERHDIIGDVRGRGLMVGMELVTDRKEKTPAKAETAVLFEKLREXXXXXXXXXXXXXXFRIKPPMCFTKDDADFLVDALDYSMSKL 456
            V TT EIA   +      FNT+GGNPV  A GLAVL +I+ E  Q +   VG++L   L+  + +H +IGD+RG GL +G++LV D  ++TPA AE   +  K++E               +IKPPMCFT++DA F+VD LD  ++ L
Sbjct:  289 VVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVL 436          
BLAST of EY755995 vs. ExPASy Swiss-Prot
Match: AT2L1_BOVIN (Alanine--glyoxylate aminotransferase 2-like 1 OS=Bos taurus GN=AGXT2L1 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.070e-25
Identity = 62/142 (43.66%), Postives = 85/142 (59.86%), Query Frame = 1
Query:   19 VATTPEIANVMAQKIQ--FNTFGGNPVCSAGGLAVLRVIDKERRQAHCADVGSHLLGRLRTLQERHDIIGDVRGRGLMVGMELVTDRKEKTPAKAETAVLFEKLREXXXXXXXXXXXXXXFRIKPPMCFTKDDADFLVDALD 438
            V TT EIA   +      FNT+GGNPV SA GLAVL VI  E  Q +   VG++L   L   + +H +IGD+RG GL +G++LV D +++TPA AE   +  K++E               +IKPPMCFT++DA F+V+ LD
Sbjct:  289 VVTTKEIAEAFSASGMEYFNTYGGNPVSSAVGLAVLDVIKNEDLQGNATRVGNYLTELLNKQKTKHTLIGDIRGVGLFIGIDLVKDHQQRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVEQLD 430          
BLAST of EY755995 vs. ExPASy Swiss-Prot
Match: AT2L1_XENLA (Alanine--glyoxylate aminotransferase 2-like 1 OS=Xenopus laevis GN=agxt2l1 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.114e-25
Identity = 63/148 (42.57%), Postives = 85/148 (57.43%), Query Frame = 1
Query:   19 VATTPEIANVMAQKIQ--FNTFGGNPVCSAGGLAVLRVIDKERRQAHCADVGSHLLGRLRTLQERHDIIGDVRGRGLMVGMELVTDRKEKTPAKAETAVLFEKLREXXXXXXXXXXXXXXFRIKPPMCFTKDDADFLVDALDYSMSKL 456
            V TT EIA          FNTFGGNPV  A GLAVL +I+KE  + +   VG++L   L   +++H +IGD+RG GL VG++LV DR  +TPA AE   +  KL+E               + KPPMCF K+DA  +VD +D  ++ L
Sbjct:  290 VVTTKEIAEAFGATGMEYFNTFGGNPVSCAIGLAVLDIIEKEDLRGNATTVGNYLTELLNEQKQKHPLIGDIRGVGLFVGVDLVKDRLFRTPATAEAQHIIYKLKEKRILLSADGPYRNVLKFKPPMCFNKEDAKLVVDEIDQCLTAL 437          
BLAST of EY755995 vs. ExPASy Swiss-Prot
Match: AGT2_MOUSE (Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus GN=Agxt2 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.002e-23
Identity = 59/137 (43.07%), Postives = 85/137 (62.04%), Query Frame = 1
Query:   16 AVATTPEIANVMAQKI-QFNTFGGNPVCSAGGLAVLRVIDKERRQAHCADVGSHLLGRLRTLQERHDIIGDVRGRGLMVGMELVTDRKEKTP-AKAETAVLFEKLREXXXXXXXXXXXXXXFRIKPPMCFTKDDADF 420
            AV TTPEIA  +A+++  F+TFGGNP+  A G AVL VI++E  Q +  +VG+++L +   L++  DI+GDVRG+GLMVG+E+V D+  + P  K E   + E  ++              FRI PPMC TK + DF
Sbjct:  359 AVVTTPEIAKSLAKRLLHFSTFGGNPLACAIGSAVLEVIEEENLQRNSQEVGTYMLLKFAKLRDEFDIVGDVRGKGLMVGIEMVQDKISRQPLPKTEVNQIHEDCKDMGLLVGRGGNFSQTFRIVPPMCVTKMEVDF 495          
BLAST of EY755995 vs. ExPASy Swiss-Prot
Match: AT2L2_MOUSE (Alanine--glyoxylate aminotransferase 2-like 2 OS=Mus musculus GN=Agxt2l2 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.709e-23
Identity = 57/124 (45.97%), Postives = 72/124 (58.06%), Query Frame = 1
Query:   67 FNTFGGNPVCSAGGLAVLRVIDKERRQAHCADVGSHLLGRLRTLQERHDIIGDVRGRGLMVGMELVTDRKEKTPAKAETAVLFEKLREXXXXXXXXXXXXXXFRIKPPMCFTKDDADFLVDALD 438
            FNTFGGNPV  A GLAVL V+  E+ QAH  +VGS LL  L   + +H IIGDVRG GL +G++L+ D   +TPA  E   L  +L+E               + KPPMCF  D+A  +V  LD
Sbjct:  307 FNTFGGNPVSCAVGLAVLDVLKTEQLQAHATNVGSFLLEHLTQQKAKHPIIGDVRGTGLFIGVDLIKDETLRTPATEEAEYLVSRLKENYILLSIDGPGKNILKFKPPMCFNVDNAQHVVAKLD 430          
The following BLAST results are available for this feature:
BLAST of EY755995 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
AGT21_ARATH2.524e-5975.68Alanine--glyoxylate aminotransferase 2 homolog 1, ... [more]
AGT22_ARATH1.258e-4258.11Alanine--glyoxylate aminotransferase 2 homolog 2, ... [more]
AGT23_ARATH1.701e-3954.05Alanine--glyoxylate aminotransferase 2 homolog 3, ... [more]
AT2L1_MOUSE3.327e-2741.18Alanine--glyoxylate aminotransferase 2-like 1 OS=M... [more]
AT2L1_DANRE5.675e-2743.92Alanine--glyoxylate aminotransferase 2-like 1 OS=D... [more]
AT2L1_HUMAN1.070e-2541.89Alanine--glyoxylate aminotransferase 2-like 1 OS=H... [more]
AT2L1_BOVIN1.070e-2543.66Alanine--glyoxylate aminotransferase 2-like 1 OS=B... [more]
AT2L1_XENLA3.114e-2542.57Alanine--glyoxylate aminotransferase 2-like 1 OS=X... [more]
AGT2_MOUSE1.002e-2343.07Alanine--glyoxylate aminotransferase 2, mitochondr... [more]
AT2L2_MOUSE1.709e-2345.97Alanine--glyoxylate aminotransferase 2-like 2 OS=M... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-D06-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755995 ID=EY755995|Name=EY755995|organism=Citrus sinensis|type=EST|length=571bp
CCACGCGTCCGAGGAGCTGTAGCCACCACACCAGAAATAGCAAATGTAAT
GGCTCAAAAGATTCAGTTTAACACTTTTGGCGGAAACCCGGTGTGTTCTG
CTGGTGGACTTGCTGTGCTCAGGGTCATTGATAAAGAAAGGCGGCAAGCA
CACTGTGCTGATGTTGGTTCCCACTTGCTTGGACGCTTGAGAACTTTACA
AGAGAGACATGATATCATTGGAGATGTAAGAGGGAGAGGCCTAATGGTGG
GGATGGAATTGGTAACTGACAGGAAGGAGAAGACACCTGCCAAGGCAGAA
ACTGCAGTCTTGTTTGAGAAGCTTAGAGAACTCGGTGTTCTCGTTGGCAA
AGGAGGACTACATGGAAATGTTTTCAGAATTAAGCCACCAATGTGTTTTA
CAAAAGATGATGCAGATTTTCTAGTTGATGCTTTGGACTATTCCATGTCA
AAGTTGTGAAGATAAATCTGTTACAAGCTGGGGAAAATCATGTAACATTT
CAAATCCTCTGAATATCGGACTCTATAGAGAGCTTAGTTTCAATAAAAAA
AAAAAAAAAAAAAAAAAAAAA
back to top