EY755993

Overview
NameEY755993
Unique NameEY755993
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length903
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY755993 vs. ExPASy Swiss-Prot
Match: HERC2_DROME (Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 2.660e-16
Identity = 52/135 (38.52%), Postives = 75/135 (55.56%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLG 479
            DG+V +WG G  G LGHGN      P++V+AL   K   VA G   +  +S  G++Y++G GE   LGH          +   L P+LVT+L     RVVQ++  +    +A T ALTE G ++++G GD G+LG
Sbjct: 3091 DGKVFSWGEGEDGKLGHGNRTTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWGLGEYGRLGH--------GDNTTQLKPKLVTAL--AGRRVVQVACGSR---DAQTLALTEDGAVFSWGDGDFGKLG 3212          

HSP 2 Score: 68.9366 bits (167), Expect = 4.395e-11
Identity = 41/136 (30.15%), Postives = 71/136 (52.21%), Query Frame = 3
Query:   72 QDGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLG 479
            +DG V +WG G +G LG G  E    P  ++ L+ +  V +  G   +  ++  G+V+++G G+   LGH       G++H  V  PQ +  L+    RV+ +++        H  A+T++G++YA+G  D GQ G
Sbjct: 3196 EDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTWGKGDYYRLGHG------GDQH--VRKPQPIGGLR--GRRVIHVAV-----GALHCLAVTDAGQVYAWGDNDHGQQG 3316          
BLAST of EY755993 vs. ExPASy Swiss-Prot
Match: HERC2_MOUSE (Probable E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 6.553e-15
Identity = 50/137 (36.50%), Postives = 77/137 (56.20%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVA--TGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLG 479
            +G + TWG G YG LGHG+ E E++P +V  L  +K + VA  +GD  T  V+E+G V+S+G G+   LG    +DG         TP+L+  L+ ++   V+     SI       ALT+ G++Y++G GD  +LG
Sbjct:  570 EGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGG-SDG-------CKTPKLIEKLQDLDVIKVRCGSQFSI-------ALTKDGQVYSWGKGDNQRLG 691          

HSP 2 Score: 72.7886 bits (177), Expect = 3.044e-12
Identity = 45/135 (33.33%), Postives = 72/135 (53.33%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLG 479
            +G V +WG    G LGHGN      P+V+++L  ++ V VA G   +  V+  GD+Y++G G    LGH+   D         L P+LV +L+    RV+ I+  +    +A T  LT+   ++++G GD G+LG
Sbjct: 4059 EGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSED--------QLKPKLVEALQ--GHRVIDIACGSG---DAQTLCLTDDDTVWSWGDGDYGKLG 4180          

HSP 3 Score: 72.4034 bits (176), Expect = 3.975e-12
Identity = 45/138 (32.61%), Postives = 75/138 (54.35%), Query Frame = 3
Query:   78 GRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKA----VHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLG 479
            G V +WG G  G LGHG+      PKV+ A +  +A    VH+A G   +  ++ +G++Y++G G    LGH +  D           P LV  LK +  +V+ ++  +    +A T A+TE+G+++++G GD G+LG
Sbjct:  515 GEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSED--------EAIPMLVAGLKGL--KVIDVACGSG---DAQTLAVTENGQVWSWGDGDYGKLG 639          

HSP 4 Score: 70.0922 bits (170), Expect = 1.973e-11
Identity = 38/134 (28.36%), Postives = 73/134 (54.48%), Query Frame = 3
Query:   72 QDGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQ 473
            ++G+V +WG G YG LG G  +    PK+++ L D+  + V  G   +  +++DG VYS+G G++  LGH            +V  P+L+  L+   ++V+ ++  ++     H   LTE  +++++G+ D+ Q
Sbjct:  623 ENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVIKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGT--------EEHVRYPKLLEGLQ--GKKVIDVAAGST-----HCLVLTEDSEVHSWGSNDQCQ 741          

HSP 5 Score: 69.3218 bits (168), Expect = 3.365e-11
Identity = 43/135 (31.85%), Postives = 73/135 (54.07%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLG 479
            DG+V +WG G  G LGH +      P+++QAL   +   +A G   +  ++  G++Y++G GE   LGH          +   L P++V  L  +  RV+Q++  +    +A T ALT+ G ++++G GD G+LG
Sbjct: 3066 DGKVFSWGEGDDGKLGHFSRMNCDKPRLIQALKTKRIRDIAYGSSHSAPLTSSGELYTWGLGEYGRLGH--------GDNTTQLKPKMVKVL--LGHRVIQVACGSR---DAQTLALTDEGLVFSWGDGDFGKLG 3187          
BLAST of EY755993 vs. ExPASy Swiss-Prot
Match: HERC2_HUMAN (Probable E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.553e-15
Identity = 49/137 (35.77%), Postives = 79/137 (57.66%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVA--TGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLG 479
            +G + TWG G YG LGHG+ E E++P +V  L  +K + VA  +GD  T  V+E+G V+S+G G+   LG    +DG         TP+L+  L+ ++  VV++   +       + ALT+ G++Y++G GD  +LG
Sbjct:  569 EGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGG-SDG-------CKTPKLIEKLQDLD--VVKVRCGSQF-----SIALTKDGQVYSWGKGDNQRLG 690          

HSP 2 Score: 73.1738 bits (178), Expect = 2.331e-12
Identity = 46/135 (34.07%), Postives = 72/135 (53.33%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLG 479
            +G V +WG    G LGHGN      P+V+++L  ++ V VA G   +  V+  GD+Y++G G    LGH+   D         L P+LV +L+    RVV I+  +    +A T  LT+   ++++G GD G+LG
Sbjct: 4057 EGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSED--------QLKPKLVEALQ--GHRVVDIACGSG---DAQTLCLTDDDTVWSWGDGDYGKLG 4178          

HSP 3 Score: 72.4034 bits (176), Expect = 3.975e-12
Identity = 45/138 (32.61%), Postives = 75/138 (54.35%), Query Frame = 3
Query:   78 GRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKA----VHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLG 479
            G V +WG G  G LGHG+      PKV+ A +  +A    VH+A G   +  ++ +G++Y++G G    LGH +  D           P LV  LK +  +V+ ++  +    +A T A+TE+G+++++G GD G+LG
Sbjct:  514 GEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSED--------EAIPMLVAGLKGL--KVIDVACGSG---DAQTLAVTENGQVWSWGDGDYGKLG 638          

HSP 4 Score: 72.0182 bits (175), Expect = 5.192e-12
Identity = 40/134 (29.85%), Postives = 74/134 (55.22%), Query Frame = 3
Query:   72 QDGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQ 473
            ++G+V +WG G YG LG G  +    PK+++ L D+  V V  G   +  +++DG VYS+G G++  LGH            +V  P+L+  L+   ++V+ ++  ++     H  ALTE  +++++G+ D+ Q
Sbjct:  622 ENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVVKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGT--------EEHVRYPKLLEGLQ--GKKVIDVAAGST-----HCLALTEDSEVHSWGSNDQCQ 740          

HSP 5 Score: 69.3218 bits (168), Expect = 3.365e-11
Identity = 42/135 (31.11%), Postives = 73/135 (54.07%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLG 479
            DG+V +WG G  G LGH +      P++++AL   +   +A G   +  ++  G++Y++G GE   LGH          +   L P++V  L  +  RV+Q++  +    +A T ALT+ G ++++G GD G+LG
Sbjct: 3065 DGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGELYTWGLGEYGRLGH--------GDNTTQLKPKMVKVL--LGHRVIQVACGSR---DAQTLALTDEGLVFSWGDGDFGKLG 3186          
BLAST of EY755993 vs. ExPASy Swiss-Prot
Match: HERC1_HUMAN (Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.460e-14
Identity = 51/155 (32.90%), Postives = 83/155 (53.55%), Query Frame = 3
Query:   72 QDGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKL-YAFGAGDKGQLGIELVNNQTERGNPERVDI 533
            + G V +WG G YG LGHGN + +  P+ ++AL   + V ++ G   + VV+ DG +++FG G+   L       G GN  +N   P+ VT+L+      V   L        HT A++  G + +AFG GD G+LG+    N T + +P+++D+
Sbjct: 4099 ESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRL-------GLGNT-SNKKLPERVTALEGYQIGQVACGLN-------HTLAVSADGSMVWAFGDGDYGKLGL---GNSTAKSSPQKIDV 4235          

HSP 2 Score: 75.485 bits (184), Expect = 4.696e-13
Identity = 51/137 (37.23%), Postives = 75/137 (54.74%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNEECESVPKVVQA-LNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGK-LYAFGAGDKGQLG 479
            +G V +WG G YG LGHGN   +  PK++Q  L     V V+ G   +  V+EDG++Y++G G+   LGH     G  N   N+  P LV  +  V E    +S  +S     HT AL++ G+ +++FG GD G+LG
Sbjct:  476 EGEVFSWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVTEDGELYTWGEGDFGRLGH-----GDSNSR-NI--PTLVKDISNVGE----VSCGSS-----HTIALSKDGRTVWSFGGGDNGKLG 595          

HSP 3 Score: 68.9366 bits (167), Expect = 4.395e-11
Identity = 45/131 (34.35%), Postives = 74/131 (56.49%), Query Frame = 3
Query:   72 QDGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDG-DVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAG 461
            +DG + TWG G +G LGHG+    ++P +V+ +++V    V+ G   T  +S+DG  V+SFG G++  LGH     G  NR   V  P+++ +L+ +  R V     +S+       ALT +G++YA+G G
Sbjct:  528 EDGELYTWGEGDFGRLGHGDSNSRNIPTLVKDISNVG--EVSCGSSHTIALSKDGRTVWSFGGGDNGKLGH-----GDTNR---VYKPKVIEALQGMFIRKVCAGSQSSL-------ALTSTGQVYAWGCG 641          

HSP 4 Score: 67.781 bits (164), Expect = 9.792e-11
Identity = 51/154 (33.12%), Postives = 75/154 (48.70%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVAT---GDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNNQTERGNPERV 527
            +G V   G G YG LG GN +   V  V+ AL       + T    D  +  ++E G+V+S+G G+   LGH     G  +R      P+ + +L+   E VVQ+S         H+  +T  GKL+ FG GD G+LG+    N + +  PERV
Sbjct: 4045 NGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGH-----GNSDRQRR---PRQIEALQ--GEEVVQMSCGFK-----HSAVVTSDGKLFTFGNGDYGRLGL---GNTSNKKLPERV 4180          
BLAST of EY755993 vs. ExPASy Swiss-Prot
Match: HERC5_HUMAN (Probable E3 ubiquitin-protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.044e-12
Identity = 47/135 (34.81%), Postives = 74/135 (54.81%), Query Frame = 3
Query:   78 GRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFA-LTESGKLYAFGAGDKGQLG 479
            G + +WG    G LG G+ E +  P +++ L++ K   VA G   + ++++DG +++FG G+   LGHN+          N L P LV  L  V  RV QI+      W  HT A +++ GK+++FG+G  GQLG
Sbjct:  210 GNIYSWGKNECGQLGLGHTESKDDPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGAGKHGQLGHNST--------QNELRPCLVAEL--VGYRVTQIACGR---W--HTLAYVSDLGKVFSFGSGKDGQLG 329          
BLAST of EY755993 vs. ExPASy Swiss-Prot
Match: HERC3_HUMAN (Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.856e-12
Identity = 50/152 (32.89%), Postives = 74/152 (48.68%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNE-ECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNNQTERGNPERV 527
            DG+  TWG   +G LG G E   ++ P+ V++L  +    VA G   +F +S  G V+ +G   +  LG +   D +   H  +L  Q          +VV IS         HT  LT+SG ++ FGAG  GQLG + +N++    NP RV
Sbjct:  155 DGQFFTWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLLRTQ----------KVVYISCGEE-----HTAVLTKSGGVFTFGAGSCGQLGHDSMNDEV---NPRRV 288          
BLAST of EY755993 vs. ExPASy Swiss-Prot
Match: RCBT1_HUMAN (RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.511e-11
Identity = 49/142 (34.51%), Postives = 69/142 (48.59%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNEECESVP-KVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNN 497
            DG V  WG+   G +G G+   +  P KV   L+  + V +A G  ++  V ++G+VY +G   +  LG        GN + N LTP  V +L  V        +   +   AHT ALT+ G LYA+GA   GQLG    NN
Sbjct:  146 DGEVFAWGYNNCGQVGSGSTANQPTPRKVTNCLHIKRVVGIACGQTSSMAVLDNGEVYGWGYNGNGQLG-------LGN-NGNQLTPVRVAALHSV-------CVNQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGNKNN 272          
BLAST of EY755993 vs. ExPASy Swiss-Prot
Match: HERC6_HUMAN (Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 2.577e-11
Identity = 47/148 (31.76%), Postives = 67/148 (45.27%), Query Frame = 3
Query:   78 GRVCTWGWGRYGCLGHGN-EECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNNQTERGNP 518
            GRV  WG G  G LG G  +E    PK +  LND+K + V+ G Y +  +S+D  V+S+G      L       G G    +  +PQ V SL+        I L       AH+FAL+  G  + +G+   GQL +   N   +   P
Sbjct:   94 GRVFAWGAGSEGQLGIGEFKEISFTPKKIMTLNDIKIIQVSCGHYHSLALSKDSQVFSWGKNSHGQL-------GLGKEFPSQASPQRVRSLE-------GIPLAQVAAGGAHSFALSLCGTSFGWGSNSAGQLALSGRNVPVQSNKP 227          
BLAST of EY755993 vs. ExPASy Swiss-Prot
Match: RCBT1_MOUSE (RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.365e-11
Identity = 47/142 (33.10%), Postives = 69/142 (48.59%), Query Frame = 3
Query:   75 DGRVCTWGWGRYGCLGHGNEECESVP-KVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNN 497
            DG +  WG+   G +G G+   +  P KV   L+  + V++A G  ++  V + G+VY +G   +  LG        GN + N LTP  V +L  +        +   +   AHT ALT+ G LYA+GA   GQLG    NN
Sbjct:  146 DGELFAWGYNNCGQVGSGSTANQPTPRKVTNCLHTKRVVNIACGQTSSMAVLDSGEVYGWGYNGNGQLG-------LGN-NGNQLTPVRVAALHGM-------CVNQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGSKNN 272          
BLAST of EY755993 vs. ExPASy Swiss-Prot
Match: HERC4_RAT (Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.395e-11
Identity = 44/151 (29.14%), Postives = 73/151 (48.34%), Query Frame = 3
Query:   78 GRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKAVHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIADGQGNRHANVLTPQLVTSLKQVNERVVQISLTNSIYWNAHTFA-LTESGKLYAFGAGDKGQLGIELVNNQ----TERGN 515
            G +  WG  ++G LG  +E    VP ++++L   K V++  G+  T  ++++G V++FG G    LGHN+ +     R    L   +VT +    +               HT A +  SG++Y+FG G  GQLG    +N+    T +GN
Sbjct:  209 GAIFGWGRNKFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTQIACGRQ---------------HTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGN 344          
The following BLAST results are available for this feature:
BLAST of EY755993 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
HERC2_DROME2.660e-1638.52Probable E3 ubiquitin-protein ligase HERC2 OS=Dros... [more]
HERC2_MOUSE6.553e-1536.50Probable E3 ubiquitin-protein ligase HERC2 OS=Mus ... [more]
HERC2_HUMAN6.553e-1535.77Probable E3 ubiquitin-protein ligase HERC2 OS=Homo... [more]
HERC1_HUMAN1.460e-1432.90Probable E3 ubiquitin-protein ligase HERC1 OS=Homo... [more]
HERC5_HUMAN3.044e-1234.81Probable E3 ubiquitin-protein ligase HERC5 OS=Homo... [more]
HERC3_HUMAN8.856e-1232.89Probable E3 ubiquitin-protein ligase HERC3 OS=Homo... [more]
RCBT1_HUMAN1.511e-1134.51RCC1 and BTB domain-containing protein 1 OS=Homo s... [more]
HERC6_HUMAN2.577e-1131.76Probable E3 ubiquitin-protein ligase HERC6 OS=Homo... [more]
RCBT1_MOUSE3.365e-1133.10RCC1 and BTB domain-containing protein 1 OS=Mus mu... [more]
HERC4_RAT4.395e-1129.14Probable E3 ubiquitin-protein ligase HERC4 OS=Ratt... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-D04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755993 ID=EY755993|Name=EY755993|organism=Citrus sinensis|type=EST|length=903bp
CCACGCGTCCGCTATTGAATCTGCAGCCAGTGGTGGTTGCAGCTGGTGCC
TGGCATGCAGCTGTTGTCGGGCAAGATGGACGTGTTTGCACATGGGGTTG
GGGGCGTTATGGATGCTTGGGTCATGGAAATGAAGAGTGTGAATCAGTTC
CTAAGGTGGTGCAAGCATTGAACGATGTGAAAGCAGTTCATGTTGCTACA
GGGGATTACACAACCTTTGTGGTCTCTGAAGATGGTGATGTATATTCATT
TGGTTGTGGTGAATCAGCTAGTCTTGGTCACAATGCTATTGCAGATGGAC
AGGGAAATAGACATGCAAATGTGTTGACTCCACAGCTAGTAACATCATTG
AAGCAAGTCAACGAGCGGGTTGTACAGATCAGCCTGACTAATTCCATATA
TTGGAATGCCCATACTTTCGCACTCACTGAATCAGGAAAGCTATATGCAT
TTGGCGCAGGAGACAAGGGCCAGCTAGGCATAGAACTAGTTAACAATCAA
ACCGAAAGGGGAAACCCGGAGAGGGTTGACATCGATCTCAGTTAGCAATT
AAATGGCTTCACCAACCCTCATATCTGACACCGTGCCATATTGCCATTCT
GCCAATTCATCATTTAGACGACTGCATTTGGTGTTTAGATTCCTTGTTTA
TTTTGTAAATAGNACAAAGAAAGAATTGTGNAGGTTCAAAGTTTAGGCAT
AGCAGGGGCCATAGCAATGCAGGATGGTGCATGTTTGAAAATATTGTTAG
CACATAGACATAGGCCTCTAGCCGAAGCTGGTAATATAGCTGATACATTT
GGCAGGGTCATTGATATTTATTTTATGGTGAATTGCATAAAAAAAAAAAA
AAAAAAAAAAAATAGGCGGCCCTCTAAAGATTCAAGTTACTACGCTGCAT
GCG
back to top