EY755990

Overview
NameEY755990
Unique NameEY755990
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length913
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY755990_ssr711 microsatellite EY755990_ssr711:711..725. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY755990 vs. ExPASy Swiss-Prot
Match: PIP21_ARATH (Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1 PE=1 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.728e-63
Identity = 116/130 (89.23%), Postives = 120/130 (92.31%), Query Frame = 3
Query:   12 YYTMHGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 401
            YYT +GGGAN LADGYSTG GLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYNK K WDD W+FWVGPFIGAAIAAFYHQF+LRA   K+LG
Sbjct:  150 YYTRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLG 279          
BLAST of EY755990 vs. ExPASy Swiss-Prot
Match: PIP25_ARATH (Probable aquaporin PIP2-5 OS=Arabidopsis thaliana GN=PIP2-5 PE=1 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.948e-63
Identity = 114/130 (87.69%), Postives = 123/130 (94.62%), Query Frame = 3
Query:   12 YYTMHGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 401
            Y+T +GGGAN L+DGYS G G+AAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSLGAA+IYNKDKAWD  W+FWVGPF GAAIAAFYHQF+LRAGA+KALG
Sbjct:  149 YFTRYGGGANGLSDGYSIGTGVAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAIIYNKDKAWDHHWIFWVGPFAGAAIAAFYHQFVLRAGAIKALG 278          
BLAST of EY755990 vs. ExPASy Swiss-Prot
Match: PIP24_ARATH (Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.948e-63
Identity = 115/130 (88.46%), Postives = 121/130 (93.08%), Query Frame = 3
Query:   12 YYTMHGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 401
            YYT +GGGANELADGY+ G GL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYN +KAWDDQW+FWVGP IGAA AAFYHQFILRA A+KALG
Sbjct:  150 YYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALG 279          
BLAST of EY755990 vs. ExPASy Swiss-Prot
Match: PIP24_MAIZE (Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 3.259e-62
Identity = 114/127 (89.76%), Postives = 119/127 (93.70%), Query Frame = 3
Query:   12 YYTMHGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVK 392
            YY  +GGGANEL+DGYS G GLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQW+FWVGP IGAAIAA YHQ++LRA A K
Sbjct:  154 YYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK 280          
BLAST of EY755990 vs. ExPASy Swiss-Prot
Match: PIP23_MAIZE (Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 3.259e-62
Identity = 114/127 (89.76%), Postives = 119/127 (93.70%), Query Frame = 3
Query:   12 YYTMHGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVK 392
            YY  +GGGANEL+DGYS G GLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQW+FWVGP IGAAIAA YHQ++LRA A K
Sbjct:  155 YYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK 281          
BLAST of EY755990 vs. ExPASy Swiss-Prot
Match: PIP21_MAIZE (Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2)

HSP 1 Score: 238.81 bits (608), Expect = 3.259e-62
Identity = 112/130 (86.15%), Postives = 120/130 (92.31%), Query Frame = 3
Query:   12 YYTMHGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 401
            Y+  +GGGAN LA GYS G GL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSLGAAVIYNKDK WDD W+FWVGP +GAAIAAFYHQ+ILRAGA+KALG
Sbjct:  155 YFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKALG 284          
BLAST of EY755990 vs. ExPASy Swiss-Prot
Match: PIP22_ARATH (Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2)

HSP 1 Score: 238.424 bits (607), Expect = 4.257e-62
Identity = 113/130 (86.92%), Postives = 119/130 (91.54%), Query Frame = 3
Query:   12 YYTMHGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 401
            YY  +GGGAN LADGY+TG GLAAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYNK K WDD W+FWVGPFIGAAIAAFYHQF+LRA   K+LG
Sbjct:  148 YYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLG 277          
BLAST of EY755990 vs. ExPASy Swiss-Prot
Match: PIP26_ARATH (Probable aquaporin PIP2-6 OS=Arabidopsis thaliana GN=PIP2-6 PE=1 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 5.560e-62
Identity = 110/130 (84.62%), Postives = 121/130 (93.08%), Query Frame = 3
Query:   12 YYTMHGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 401
            YY  +GGGAN L+DGY+ GVG+ AEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGF+VFMVHLATIPITGTGINPARS GAAVIYN  KAWDDQW+FWVGPF+GAAIAAFYHQF+LRAGA+KA G
Sbjct:  149 YYNRYGGGANMLSDGYNVGVGVGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINPARSFGAAVIYNNQKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAGAMKAYG 278          
BLAST of EY755990 vs. ExPASy Swiss-Prot
Match: PIP22_MAIZE (Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 7.261e-62
Identity = 110/130 (84.62%), Postives = 120/130 (92.31%), Query Frame = 3
Query:   12 YYTMHGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 401
            Y+  +GGGAN LA GYS G GL AEI+GTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSLGAAV+YNKDK WDD W+FWVGP +GAAIAAFYHQ+ILRAGA+KALG
Sbjct:  157 YFDRYGGGANSLASGYSRGAGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFYHQYILRAGAIKALG 286          
BLAST of EY755990 vs. ExPASy Swiss-Prot
Match: PIP22_ORYSJ (Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 8.028e-61
Identity = 110/127 (86.61%), Postives = 117/127 (92.13%), Query Frame = 3
Query:   12 YYTMHGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVK 392
            YY  +GGGANEL+DGYS G GL AEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSLG AVIYNKDKAWDDQW+FWVGP IGAAIAA YHQ++LRA A K
Sbjct:  154 YYARYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGTAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK 280          
The following BLAST results are available for this feature:
BLAST of EY755990 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
PIP21_ARATH1.728e-6389.23Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1... [more]
PIP25_ARATH2.948e-6387.69Probable aquaporin PIP2-5 OS=Arabidopsis thaliana ... [more]
PIP24_ARATH2.948e-6388.46Probable aquaporin PIP2-4 OS=Arabidopsis thaliana ... [more]
PIP24_MAIZE3.259e-6289.76Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1[more]
PIP23_MAIZE3.259e-6289.76Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1[more]
PIP21_MAIZE3.259e-6286.15Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2[more]
PIP22_ARATH4.257e-6286.92Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2... [more]
PIP26_ARATH5.560e-6284.62Probable aquaporin PIP2-6 OS=Arabidopsis thaliana ... [more]
PIP22_MAIZE7.261e-6284.62Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1[more]
PIP22_ORYSJ8.028e-6186.61Probable aquaporin PIP2-2 OS=Oryza sativa subsp. j... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-C12-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755990 ID=EY755990|Name=EY755990|organism=Citrus sinensis|type=EST|length=913bp
CCACGCGTCCGTACTACACAATGCACGGAGGTGGGGCCAACGAGCTGGCC
GATGGGTACAGCACAGGCGTTGGATTGGCCGCCGAGATCATCGGCACCTT
TGTGTTGGTTTACACTGTCTTCTCGGCCACTGATCCCAAGAGAAGCGCCA
GAGACTCCCATGTCCCCGTTTTGGCACCGCTCCCCATTGGATTTGCTGTG
TTCATGGTACACTTGGCCACAATCCCAATCACTGGCACTGGCATTAACCC
AGCAAGGAGTCTCGGGGCCGCTGTTATTTACAACAAGGACAAGGCTTGGG
ATGATCAATGGCTCTTCTGGGTTGGACCCTTCATCGGTGCAGCAATTGCG
GCTTTCTACCACCAATTCATCTTGAGAGCTGGAGCTGTCAAGGCTCTTGG
TTCATTCAGGAGCCAATCCCGTGTCTGATTTTAGTTTCGACAAGTGGATT
ATCCACATCTTCATGGGGTTAATGATTTAAAATTGGAAAGAAAAAACTGG
GAAGGAGTAGAGGTGTGTTAAGTTTCAAAAAGTGAATAATGAGGGGGGGT
GTGATTTGTGCTTTCAAGGAGTTGTAGGCAAAAAGTCTCTTAGACAATGA
GGGGGCTTGCTTTTTTGTAATCCCCTCTGTTGTTTTCAAGCACTTTCCTT
AGAATTCACTTCTTCAATGTTTCTGTCTCTTTCTACTTTGTATTATTTTC
TCCGNATGTGATTATTATTATTATTGTTGTGCTTTTAGGAAAAAAAAAAA
TATTACCTATGTTGTCATTTTAACAANCCAACCACCCACCTACACCTCTC
CATCACAACTATAACCACCTTTTACACACCTTTACCACACACCACTCTTC
TCTTCCCCCCCTTCCCACCCTTTACCTCTCAAGAGGGGGCCCCCTCTAAG
AGACCCCTCTCCC
back to top