EY755989

Overview
NameEY755989
Unique NameEY755989
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length516
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2179 contig Csv1_Contig2179:361..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755989 vs. ExPASy Swiss-Prot
Match: PSAL_CUCSA (Photosystem I reaction center subunit XI, chloroplastic OS=Cucumis sativus GN=PSAL PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 9.001e-44
Identity = 86/121 (71.07%), Postives = 94/121 (77.69%), Query Frame = 1
Query:   13 SPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKXXXXXXXXXISGVIWAYFLLYVLNLPYFVK 375
            SPLLRG+EVGLAHGF LVGPFVKAGPLRNT              +VILS+CLT+YG+ASF+EGEPSTAP LTLTGRKK PD LQTADGWAK         ISGVIWAYFLLYVL+LPY+VK
Sbjct:   97 SPLLRGIEVGLAHGFFLVGPFVKAGPLRNTAYAGGAGSLAAGGLIVILSVCLTMYGVASFNEGEPSTAPSLTLTGRKKTPDPLQTADGWAKFSGGFFFGGISGVIWAYFLLYVLDLPYYVK 217          
BLAST of EY755989 vs. ExPASy Swiss-Prot
Match: PSAL_ARATH (Photosystem I reaction center subunit XI, chloroplastic OS=Arabidopsis thaliana GN=PSAL PE=1 SV=2)

HSP 1 Score: 175.252 bits (443), Expect = 1.535e-43
Identity = 88/121 (72.73%), Postives = 93/121 (76.86%), Query Frame = 1
Query:   13 SPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKXXXXXXXXXISGVIWAYFLLYVLNLPYFVK 375
            +PLLRGVEVGLAHGF LVGPFVKAGPLRNT              VVILS+CLTIYGI+SF EGEPS AP LTLTGRKK+PDQLQTADGWAK         ISGV WAYFLLYVL+LPYFVK
Sbjct:   99 NPLLRGVEVGLAHGFFLVGPFVKAGPLRNTAYAGSAGSLAAAGLVVILSMCLTIYGISSFKEGEPSIAPSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVTWAYFLLYVLDLPYFVK 219          
BLAST of EY755989 vs. ExPASy Swiss-Prot
Match: PSAL_SPIOL (Photosystem I reaction center subunit XI, chloroplastic OS=Spinacia oleracea GN=PSAL PE=1 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 6.450e-42
Identity = 84/121 (69.42%), Postives = 93/121 (76.86%), Query Frame = 1
Query:   13 SPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKXXXXXXXXXISGVIWAYFLLYVLNLPYFVK 375
            +PLLRGVEVGLAHGFLLVGPFVKAGPLRNTE             VVILS+CLT+YGIASF EGEPS AP LTLTGRKK+PDQLQ+ADGWAK         +SGV WA FL+YVL+LPY+ K
Sbjct:   96 NPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEYAGAAGSLAAAGLVVILSMCLTMYGIASFKEGEPSIAPALTLTGRKKQPDQLQSADGWAKFTGGFFFGGVSGVTWACFLMYVLDLPYYFK 216          
BLAST of EY755989 vs. ExPASy Swiss-Prot
Match: PSAL_HORVU (Photosystem I reaction center subunit XI, chloroplastic OS=Hordeum vulgare GN=PSAL PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.757e-39
Identity = 77/121 (63.64%), Postives = 91/121 (75.21%), Query Frame = 1
Query:   13 SPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKXXXXXXXXXISGVIWAYFLLYVLNLPYFVK 375
            SPLLRG+EVGLAHG+LLVGPF   GPLRNT +            V ILS+CLT+YG+ASF+EGEPSTAP LTLTGRKKE D+LQTA+GW++         +SG +WAYFLLYVL+LPYF K
Sbjct:   89 SPLLRGIEVGLAHGYLLVGPFALTGPLRNTPVHGQAGTLGAIGLVSILSVCLTMYGVASFNEGEPSTAPVLTLTGRKKEADKLQTAEGWSQFTGGFFFGGVSGAVWAYFLLYVLDLPYFFK 209          
BLAST of EY755989 vs. ExPASy Swiss-Prot
Match: PSAL_GRATL (Photosystem I reaction center subunit XI OS=Gracilaria tenuistipitata var. liui GN=psaL PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 7.940e-16
Identity = 44/117 (37.61%), Postives = 63/117 (53.85%), Query Frame = 1
Query:   13 SPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKXXXXXXXXXISGVIWAYFLLYVLNLP 363
            SPLLRG+E+G+AHG+ LVGPF K GPLRNT++            ++IL++CL++YG  SF + +                D LQT +GW +         + G  +AY LL   N+P
Sbjct:   42 SPLLRGLEIGMAHGYFLVGPFDKLGPLRNTDVALLSGFLSAVGLIIILTVCLSMYGNVSFDKDDAK--------------DLLQTTEGWGQFTAGFLVGAVGGSGFAYLLL--ANIP 142          
BLAST of EY755989 vs. ExPASy Swiss-Prot
Match: PSAL_GUITH (Photosystem I reaction center subunit XI OS=Guillardia theta GN=psaL PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.037e-15
Identity = 41/111 (36.94%), Postives = 59/111 (53.15%), Query Frame = 1
Query:   13 SPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKXXXXXXXXXISGVIWAYFLL 345
            SPLLRG+E+G+ HG+ LVGPF K GPLRN+E+            ++I++ CL IYG+ SF+  +                +QLQ+A GW +         I G  +AY L+
Sbjct:   42 SPLLRGLEIGMTHGYFLVGPFYKLGPLRNSEVALLAGVFSALGLIIIMAACLAIYGVVSFNTNDGG--------------EQLQSAKGWRQFTSGWLVGSIGGASFAYILI 138          
BLAST of EY755989 vs. ExPASy Swiss-Prot
Match: PSAL_CYACA (Photosystem I reaction center subunit XI OS=Cyanidium caldarium GN=psaL PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.037e-15
Identity = 42/111 (37.84%), Postives = 60/111 (54.05%), Query Frame = 1
Query:   13 SPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKXXXXXXXXXISGVIWAYFLL 345
            SPLLRG+E+G+AHG+ ++GPF K GPLRNT++            ++I SI + IYGI +F   E +              D+LQTA+GW +         + G  +AY LL
Sbjct:   42 SPLLRGLEIGMAHGYFIIGPFYKLGPLRNTDLSLLSGLIAAIGLIIISSIAMIIYGIVTFDNSENN--------------DKLQTANGWRQLASGFLLGAVGGAGFAYILL 138          
BLAST of EY755989 vs. ExPASy Swiss-Prot
Match: PSAL_PORPU (Photosystem I reaction center subunit XI OS=Porphyra purpurea GN=psaL PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.769e-15
Identity = 44/117 (37.61%), Postives = 62/117 (52.99%), Query Frame = 1
Query:   13 SPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKXXXXXXXXXISGVIWAYFLLYVLNLP 363
            SPLLRG+E+G+AHG+ L+GPF K GPLR T++            ++IL+ CL++YG  SF+              R    D LQTA+GW +         + G  +AY LL   N+P
Sbjct:   42 SPLLRGLEIGMAHGYFLIGPFDKLGPLRGTDVALLAGFLSSVGLIIILTTCLSMYGNVSFT--------------RSDSKDPLQTAEGWGQFTAGFLVGAVGGSGFAYLLL--ANIP 142          
BLAST of EY755989 vs. ExPASy Swiss-Prot
Match: PSAL_PORYE (Photosystem I reaction center subunit XI OS=Porphyra yezoensis GN=psaL PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.147e-15
Identity = 43/117 (36.75%), Postives = 62/117 (52.99%), Query Frame = 1
Query:   13 SPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKXXXXXXXXXISGVIWAYFLLYVLNLP 363
            SPLLRG+E+G+AHG+ L+GPF K GPLR T++            ++IL+ CL++YG  SF+              R    D LQT++GW +         + G  +AY LL   N+P
Sbjct:   42 SPLLRGLEIGMAHGYFLIGPFDKLGPLRGTDVALLAGFLSSVGLIIILTTCLSMYGNVSFT--------------RADSKDPLQTSEGWGQFTAGFLVGAVGGSGFAYLLL--ANIP 142          
BLAST of EY755989 vs. ExPASy Swiss-Prot
Match: PSAL_TRIEI (Photosystem I reaction center subunit XI OS=Trichodesmium erythraeum (strain IMS101) GN=psaL PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.147e-14
Identity = 40/111 (36.04%), Postives = 61/111 (54.95%), Query Frame = 1
Query:   13 SPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKXXXXXXXXXISGVIWAYFLL 345
            SP+LRG+EVG+AHG+ +VGP+ K GPLR++ +            V+I +ICL+ YG+ SF    P  A            D L+T++GW++         + G + A+FLL
Sbjct:   47 SPILRGLEVGMAHGYFIVGPWTKLGPLRDSAVANLGGLISTIALVLIATICLSAYGLVSFQGKSPEGA------------DPLKTSEGWSQFTGGFFIGAMGGAVVAFFLL 145          
The following BLAST results are available for this feature:
BLAST of EY755989 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
PSAL_CUCSA9.001e-4471.07Photosystem I reaction center subunit XI, chloropl... [more]
PSAL_ARATH1.535e-4372.73Photosystem I reaction center subunit XI, chloropl... [more]
PSAL_SPIOL6.450e-4269.42Photosystem I reaction center subunit XI, chloropl... [more]
PSAL_HORVU1.757e-3963.64Photosystem I reaction center subunit XI, chloropl... [more]
PSAL_GRATL7.940e-1637.61Photosystem I reaction center subunit XI OS=Gracil... [more]
PSAL_GUITH1.037e-1536.94Photosystem I reaction center subunit XI OS=Guilla... [more]
PSAL_CYACA1.037e-1537.84Photosystem I reaction center subunit XI OS=Cyanid... [more]
PSAL_PORPU1.769e-1537.61Photosystem I reaction center subunit XI OS=Porphy... [more]
PSAL_PORYE5.147e-1536.75Photosystem I reaction center subunit XI OS=Porphy... [more]
PSAL_TRIEI1.147e-1436.04Photosystem I reaction center subunit XI OS=Tricho... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-C11-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755989 ID=EY755989|Name=EY755989|organism=Citrus sinensis|type=EST|length=516bp
CCACGCGTCCGCAGCCCACTACTGAGAGGAGTAGAGGTGGGGTTGGCCCA
TGGATTCCTCCTTGTGGGTCCATTTGTTAAGGCAGGGCCATTGAGAAACA
CAGAAATAGCAGGACCAGCAGGGTCATTGGCAGCTGGTGGCCTTGTTGTG
ATCCTCAGCATTTGCTTGACAATCTATGGAATTGCTTCATTCAGTGAAGG
AGAGCCATCCACTGCTCCAGGCTTAACATTGACCGGAAGGAAGAAGGAGC
CTGATCAGTTGCAAACAGCTGATGGGTGGGCTAAGTTCACTGGAGGATTC
TTCTTTGGTGGAATTTCTGGTGTCATTTGGGCTTATTTCCTGCTTTACGT
TCTTAACCTTCCCTACTTCGTTAAATAGAAATATGTAACATCTACTCTTT
GGTTTTAAGATCCCATGTATCTCAATTTGCTACTCTGTAAATCTACCTGT
TTGGGATGTTTATTGCAAATGAAACTTGCTTCAGTTACTGAAAAAAAAAA
AAAAAAAAAAAAAAAA
back to top