EY755988

Overview
NameEY755988
Unique NameEY755988
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length426
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13295 contig Csv1_Contig13295:1..426. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755988 vs. ExPASy Swiss-Prot
Match: SERA_ARATH (D-3-phosphoglycerate dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=At1g17745 PE=1 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 7.083e-12
Identity = 34/50 (68.00%), Postives = 39/50 (78.00%), Query Frame = 1
Query:   16 NVTVNFMSVGRIAPQKQAVMTIGVDEEPSREVLKKIGETPAIEEFVFLKL 165
            NV VNFMSVGR   +KQA+M IGVDEEP  + L++IG   AIEEFVFLKL
Sbjct:  575 NVNVNFMSVGRTVLRKQAIMAIGVDEEPDNKTLERIGGVSAIEEFVFLKL 624          
The following BLAST results are available for this feature:
BLAST of EY755988 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
SERA_ARATH7.083e-1268.00D-3-phosphoglycerate dehydrogenase, chloroplastic ... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-C10-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755988 ID=EY755988|Name=EY755988|organism=Citrus sinensis|type=EST|length=426bp
CCACGCGTCCGTAACAATGTAACTGTGAACTTCATGAGTGTGGGAAGAAT
TGCTCCACAAAAGCAAGCAGTAATGACCATTGGTGTGGATGAGGAACCCA
GCAGGGAAGTACTCAAGAAAATTGGGGAGACTCCTGCCATTGAAGAGTTT
GTTTTCCTCAAGCTATAGTGCAGCAAATCCATTCGATGTCAGTTTAGAAC
GCATTCTTAGTAGGTACTTCATGAGTGATTCTGCTTTGGGTTGTCTGTGT
AGTCATCATTCGTCCGTCAATTTGTATGAATATGTGTCTTCAAGTTCTGG
CTTCATTACATGTTAACTAGTTTCTTGAATGGTCTTACTACTCTACTTGC
CCGGGTATTGGTATTATTTCCGGTTCTTGTTATTCTCAAATTTACTTGAA
GCAAGCAAAAAAAAAAAAAAAAAAAA
back to top