EY755966

Overview
NameEY755966
Unique NameEY755966
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length515
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1472 contig Csv1_Contig1472:45..559. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755966 vs. ExPASy Swiss-Prot
Match: RUXE_DANRE (Small nuclear ribonucleoprotein E OS=Danio rerio GN=snrpe PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 9.508e-30
Identity = 59/81 (72.84%), Postives = 73/81 (90.12%), Query Frame = 2
Query:  113 KVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMN 355
            KVQ++M QPINLIFR+LQ+++RI +WL+EQ ++RIEG IIGFDEYMNLVLDDAEEVH+K   RKPLGRI+LKGDNITL+ +
Sbjct:    9 KVQKVMVQPINLIFRYLQNRSRISVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQS 89          
BLAST of EY755966 vs. ExPASy Swiss-Prot
Match: RUXE_PIG (Small nuclear ribonucleoprotein E OS=Sus scrofa GN=SNRPE PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 4.719e-29
Identity = 58/81 (71.60%), Postives = 73/81 (90.12%), Query Frame = 2
Query:  113 KVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMN 355
            KVQ++M QPINLIFR+LQ+++RIQ+WL+EQ ++RIEG IIGFDEYMNLVLDDAEE+H K  +RK LGRI+LKGDNITL+ +
Sbjct:    9 KVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of EY755966 vs. ExPASy Swiss-Prot
Match: RUXE_MOUSE (Small nuclear ribonucleoprotein E OS=Mus musculus GN=Snrpe PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 4.719e-29
Identity = 58/81 (71.60%), Postives = 73/81 (90.12%), Query Frame = 2
Query:  113 KVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMN 355
            KVQ++M QPINLIFR+LQ+++RIQ+WL+EQ ++RIEG IIGFDEYMNLVLDDAEE+H K  +RK LGRI+LKGDNITL+ +
Sbjct:    9 KVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of EY755966 vs. ExPASy Swiss-Prot
Match: RUXE_HUMAN (Small nuclear ribonucleoprotein E OS=Homo sapiens GN=SNRPE PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 4.719e-29
Identity = 58/81 (71.60%), Postives = 73/81 (90.12%), Query Frame = 2
Query:  113 KVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMN 355
            KVQ++M QPINLIFR+LQ+++RIQ+WL+EQ ++RIEG IIGFDEYMNLVLDDAEE+H K  +RK LGRI+LKGDNITL+ +
Sbjct:    9 KVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of EY755966 vs. ExPASy Swiss-Prot
Match: RUXE_CHICK (Small nuclear ribonucleoprotein E OS=Gallus gallus GN=SNRPE PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 4.719e-29
Identity = 58/81 (71.60%), Postives = 73/81 (90.12%), Query Frame = 2
Query:  113 KVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMN 355
            KVQ++M QPINLIFR+LQ+++RIQ+WL+EQ ++RIEG IIGFDEYMNLVLDDAEE+H K  +RK LGRI+LKGDNITL+ +
Sbjct:    9 KVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of EY755966 vs. ExPASy Swiss-Prot
Match: RUXE_BOVIN (Small nuclear ribonucleoprotein E OS=Bos taurus GN=SNRPE PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 4.719e-29
Identity = 58/81 (71.60%), Postives = 73/81 (90.12%), Query Frame = 2
Query:  113 KVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMN 355
            KVQ++M QPINLIFR+LQ+++RIQ+WL+EQ ++RIEG IIGFDEYMNLVLDDAEE+H K  +RK LGRI+LKGDNITL+ +
Sbjct:    9 KVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of EY755966 vs. ExPASy Swiss-Prot
Match: RUXE_DROME (Probable small nuclear ribonucleoprotein E OS=Drosophila melanogaster GN=CG18591 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.342e-28
Identity = 56/81 (69.14%), Postives = 71/81 (87.65%), Query Frame = 2
Query:  113 KVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMN 355
            KVQ++M QPINLIFR+LQ+++R+Q+WL+E   LRIEG I+GFDEYMNLVLDDAEEV++K   R+ LGRI+LKGDNITL+ N
Sbjct:    8 KVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYVKTRQRRNLGRIMLKGDNITLIQN 88          
BLAST of EY755966 vs. ExPASy Swiss-Prot
Match: RUEL1_HUMAN (Putative small nuclear ribonucleoprotein polypeptide E-like protein 1 OS=Homo sapiens GN=SNRPEL1 PE=5 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 3.995e-28
Identity = 56/81 (69.14%), Postives = 73/81 (90.12%), Query Frame = 2
Query:  113 KVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMN 355
            KVQ++M QPINLIFR+LQ++++IQ+WL+EQ +++IEG IIGFDEYMNLVLDDAEE+H K  +RK LGRI+LKGDNITL+ +
Sbjct:    9 KVQKVMVQPINLIFRYLQNRSQIQVWLYEQVNMQIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQS 89          
BLAST of EY755966 vs. ExPASy Swiss-Prot
Match: RUXE_CAEBR (Probable small nuclear ribonucleoprotein E OS=Caenorhabditis briggsae GN=snr-6 PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.571e-24
Identity = 50/83 (60.24%), Postives = 68/83 (81.93%), Query Frame = 2
Query:  101 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 349
            M+  K+Q++M QP+NLIFR+LQ++ R+QIWL+E    R+EG IIGFDE+MN+V D+AEEV++K   R  +GRILLKGDNITL+
Sbjct:    1 MSQRKIQKVMVQPVNLIFRYLQNRTRVQIWLYEDVTHRLEGYIIGFDEFMNVVFDEAEEVNMKTKGRNKIGRILLKGDNITLI 83          
BLAST of EY755966 vs. ExPASy Swiss-Prot
Match: RUXE_CAEEL (Probable small nuclear ribonucleoprotein E OS=Caenorhabditis elegans GN=snr-6 PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 7.796e-24
Identity = 49/83 (59.04%), Postives = 68/83 (81.93%), Query Frame = 2
Query:  101 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 349
            M++ K+ ++M QP+NLIFR+LQ++ R+QIWL+E    R+EG IIGFDE+MN+V D+AEEV++K   R  +GRILLKGDNITL+
Sbjct:    1 MSTRKLNKVMVQPVNLIFRYLQNRTRVQIWLYEDVTHRLEGYIIGFDEFMNVVFDEAEEVNMKTKGRNKIGRILLKGDNITLI 83          
The following BLAST results are available for this feature:
BLAST of EY755966 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
RUXE_DANRE9.508e-3072.84Small nuclear ribonucleoprotein E OS=Danio rerio G... [more]
RUXE_PIG4.719e-2971.60Small nuclear ribonucleoprotein E OS=Sus scrofa GN... [more]
RUXE_MOUSE4.719e-2971.60Small nuclear ribonucleoprotein E OS=Mus musculus ... [more]
RUXE_HUMAN4.719e-2971.60Small nuclear ribonucleoprotein E OS=Homo sapiens ... [more]
RUXE_CHICK4.719e-2971.60Small nuclear ribonucleoprotein E OS=Gallus gallus... [more]
RUXE_BOVIN4.719e-2971.60Small nuclear ribonucleoprotein E OS=Bos taurus GN... [more]
RUXE_DROME2.342e-2869.14Probable small nuclear ribonucleoprotein E OS=Dros... [more]
RUEL1_HUMAN3.995e-2869.14Putative small nuclear ribonucleoprotein polypepti... [more]
RUXE_CAEBR1.571e-2460.24Probable small nuclear ribonucleoprotein E OS=Caen... [more]
RUXE_CAEEL7.796e-2459.04Probable small nuclear ribonucleoprotein E OS=Caen... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-A10-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755966 ID=EY755966|Name=EY755966|organism=Citrus sinensis|type=EST|length=515bp
CCACGCGTCCGCAAGGTCCTTACACTGAAAAGCGCTTTCGCTCCCGCTAG
GGTTTTTCGTCTCTTGAATTCTCAAGCGTATCTCTGTGAATTCGATAGCA
ATGGCGAGCACCAAAGTTCAGAGGATTATGACTCAGCCCATTAATTTGAT
TTTCAGGTTCCTTCAAAGCAAAGCTCGCATTCAGATTTGGCTTTTTGAGC
AGAAGGATTTGAGGATTGAAGGCCGAATTATTGGTTTTGATGAGTACATG
AACTTGGTTTTGGATGATGCTGAAGAGGTTCACATAAAGAAAAATACCAG
AAAGCCATTAGGAAGGATTCTTCTCAAAGGAGACAACATAACTCTTATGA
TGAACACGGGGAAGTGATGATGGTCATTCTGGAAATCTTGTCGTCTGTCA
TTGGTTGAGCCATTTAGAGTGTATTGCTATCTTTGATGTTTGAATACTTA
ACTGGATTTCTATATGATAAGGTGATATTATATTCAGTCCATTTAAAAAA
AAAAAAAAAAAAAAA
back to top