EY755965

Overview
NameEY755965
Unique NameEY755965
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length647
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5506 contig Csv1_Contig5506:35..683. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755965 vs. ExPASy Swiss-Prot
Match: FUM2_ARATH (Fumarate hydratase 2, chloroplastic OS=Arabidopsis thaliana GN=FUM2 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.885e-48
Identity = 61/68 (89.71%), Postives = 64/68 (94.12%), Query Frame = 2
Query:  146 KISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEEFDNLVVPEKMIGPSD 349
            +ISKLLHESLMLVTSLNPKIGYDNAAAVAK+AHKEG TLK AA+KLGVL SEEFD LVVPEKMIGPSD
Sbjct:  432 RISKLLHESLMLVTSLNPKIGYDNAAAVAKRAHKEGCTLKHAAMKLGVLTSEEFDTLVVPEKMIGPSD 499          

HSP 2 Score: 92.0485 bits (227), Expect = 2.885e-48
Identity = 42/49 (85.71%), Postives = 47/49 (95.92%), Query Frame = 3
Query:    3 VGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVRGIQANRER 149
            +GGSNGHFELNVFKP+IAS LLHS+RL+ DASASFEKNCVRGI+ANRER
Sbjct:  384 IGGSNGHFELNVFKPVIASALLHSIRLIADASASFEKNCVRGIEANRER 432          
BLAST of EY755965 vs. ExPASy Swiss-Prot
Match: FUM1_ARATH (Fumarate hydratase 1, mitochondrial OS=Arabidopsis thaliana GN=FUM1 PE=1 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 2.886e-48
Identity = 61/68 (89.71%), Postives = 64/68 (94.12%), Query Frame = 2
Query:  146 KISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEEFDNLVVPEKMIGPSD 349
            +ISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEG TLK+AAL LGVL +EEFD LVVPEKMIGPSD
Sbjct:  425 RISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGCTLKEAALNLGVLTAEEFDTLVVPEKMIGPSD 492          

HSP 2 Score: 92.0485 bits (227), Expect = 2.886e-48
Identity = 43/49 (87.76%), Postives = 47/49 (95.92%), Query Frame = 3
Query:    3 VGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVRGIQANRER 149
            VGGSNGHFELNVFKP+IAS LLHS+RL+ DASASFEKNCVRGI+ANRER
Sbjct:  377 VGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVRGIEANRER 425          
BLAST of EY755965 vs. ExPASy Swiss-Prot
Match: FUMH_MACFA (Fumarate hydratase, mitochondrial OS=Macaca fascicularis GN=FH PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.371e-34
Identity = 40/66 (60.61%), Postives = 54/66 (81.82%), Query Frame = 2
Query:  146 KISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEEFDNLVVPEKMIGP 343
            +I+KL++ESLMLVT+LNP IGYD AA +AK AHK G+TLK+ A++LG L +E+FD  V P+ M+GP
Sbjct:  444 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGP 509          

HSP 2 Score: 80.4925 bits (197), Expect = 1.371e-34
Identity = 38/49 (77.55%), Postives = 41/49 (83.67%), Query Frame = 3
Query:    3 VGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVRGIQANRER 149
            VGGSNGHFELNVFKPM+   +LHS RLLGDAS SF +NCV GIQAN ER
Sbjct:  396 VGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTER 444          
BLAST of EY755965 vs. ExPASy Swiss-Prot
Match: FUMH_HUMAN (Fumarate hydratase, mitochondrial OS=Homo sapiens GN=FH PE=1 SV=3)

HSP 1 Score: 87.4261 bits (215), Expect = 1.371e-34
Identity = 40/66 (60.61%), Postives = 54/66 (81.82%), Query Frame = 2
Query:  146 KISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEEFDNLVVPEKMIGP 343
            +I+KL++ESLMLVT+LNP IGYD AA +AK AHK G+TLK+ A++LG L +E+FD  V P+ M+GP
Sbjct:  444 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGP 509          

HSP 2 Score: 80.4925 bits (197), Expect = 1.371e-34
Identity = 38/49 (77.55%), Postives = 41/49 (83.67%), Query Frame = 3
Query:    3 VGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVRGIQANRER 149
            VGGSNGHFELNVFKPM+   +LHS RLLGDAS SF +NCV GIQAN ER
Sbjct:  396 VGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTER 444          
BLAST of EY755965 vs. ExPASy Swiss-Prot
Match: FUMH_MOUSE (Fumarate hydratase, mitochondrial OS=Mus musculus GN=Fh PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 1.371e-34
Identity = 40/66 (60.61%), Postives = 54/66 (81.82%), Query Frame = 2
Query:  146 KISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEEFDNLVVPEKMIGP 343
            +I+KL++ESLMLVT+LNP IGYD AA +AK AHK G+TLK+ A++LG L +E+FD  V P+ M+GP
Sbjct:  441 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGP 506          

HSP 2 Score: 80.4925 bits (197), Expect = 1.371e-34
Identity = 38/49 (77.55%), Postives = 41/49 (83.67%), Query Frame = 3
Query:    3 VGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVRGIQANRER 149
            VGGSNGHFELNVFKPM+   +LHS RLLGDAS SF +NCV GIQAN ER
Sbjct:  393 VGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTER 441          
BLAST of EY755965 vs. ExPASy Swiss-Prot
Match: FUMH_DANRE (Fumarate hydratase, mitochondrial OS=Danio rerio GN=fh PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.326e-34
Identity = 42/66 (63.64%), Postives = 54/66 (81.82%), Query Frame = 2
Query:  146 KISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEEFDNLVVPEKMIGP 343
            +I+KL+ ESLMLVT+LNP IGYD AA +AK AHK+G+TLK+AALKLG LN ++F+  V P  M+GP
Sbjct:  443 RINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKDGSTLKEAALKLGFLNEQQFEEWVRPHDMLGP 508          

HSP 2 Score: 77.411 bits (189), Expect = 2.326e-34
Identity = 37/49 (75.51%), Postives = 40/49 (81.63%), Query Frame = 3
Query:    3 VGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVRGIQANRER 149
            VGGSNGHFELNVFKPMI   +L+S RLLGDAS SF  NCV GI+AN ER
Sbjct:  395 VGGSNGHFELNVFKPMIIKNVLNSARLLGDASVSFTNNCVVGIEANTER 443          
BLAST of EY755965 vs. ExPASy Swiss-Prot
Match: FUMH_RAT (Fumarate hydratase, mitochondrial OS=Rattus norvegicus GN=Fh PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.029e-34
Identity = 40/66 (60.61%), Postives = 53/66 (80.30%), Query Frame = 2
Query:  146 KISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEEFDNLVVPEKMIGP 343
            +I+KL++ESLMLVT+LNP IGYD AA +AK AHK G+TLK  A++LG L +E+FD  V P+ M+GP
Sbjct:  441 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKKTAIELGYLTAEQFDEWVKPKDMLGP 506          

HSP 2 Score: 80.4925 bits (197), Expect = 3.029e-34
Identity = 38/49 (77.55%), Postives = 41/49 (83.67%), Query Frame = 3
Query:    3 VGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVRGIQANRER 149
            VGGSNGHFELNVFKPM+   +LHS RLLGDAS SF +NCV GIQAN ER
Sbjct:  393 VGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTER 441          
BLAST of EY755965 vs. ExPASy Swiss-Prot
Match: FUMH_PIG (Fumarate hydratase, mitochondrial OS=Sus scrofa GN=FH PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.480e-33
Identity = 40/66 (60.61%), Postives = 52/66 (78.79%), Query Frame = 2
Query:  146 KISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEEFDNLVVPEKMIGP 343
            +I+KL++ESLMLVT+LNP IGYD AA +AK AHK G+TLK  A++LG L +E+FD  V P  M+GP
Sbjct:  400 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAVELGYLTAEQFDEWVKPRDMLGP 465          

HSP 2 Score: 79.337 bits (194), Expect = 1.480e-33
Identity = 37/49 (75.51%), Postives = 41/49 (83.67%), Query Frame = 3
Query:    3 VGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVRGIQANRER 149
            VGGSNGHFELNVFKPM+   +LHS RLLGDA+ SF +NCV GIQAN ER
Sbjct:  352 VGGSNGHFELNVFKPMMIKNVLHSARLLGDAAVSFTENCVVGIQANTER 400          
BLAST of EY755965 vs. ExPASy Swiss-Prot
Match: FUMH_RHIOR (Fumarate hydratase, mitochondrial OS=Rhizopus oryzae GN=FUMR PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.594e-32
Identity = 48/68 (70.59%), Postives = 53/68 (77.94%), Query Frame = 2
Query:  146 KISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEEFDNLVVPEKMIGPSD 349
            KIS +++ESLMLVT+LNP IGYD AA  AKKAHKEGTTLK+AAL LG L SEEFD  V PE MI   D
Sbjct:  427 KISSIMNESLMLVTALNPHIGYDKAAKCAKKAHKEGTTLKEAALSLGYLTSEEFDQWVRPEDMISAKD 494          

HSP 2 Score: 66.6254 bits (161), Expect = 1.594e-32
Identity = 30/49 (61.22%), Postives = 38/49 (77.55%), Query Frame = 3
Query:    3 VGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVRGIQANRER 149
            V GSNG FELNVFKP++   L+ S+RL+ DAS SF KNCV GI+AN ++
Sbjct:  379 VAGSNGQFELNVFKPVMIKNLIQSIRLISDASISFTKNCVVGIEANEKK 427          
BLAST of EY755965 vs. ExPASy Swiss-Prot
Match: FUMH_DICDI (Fumarate hydratase, mitochondrial OS=Dictyostelium discoideum GN=fumH PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.718e-31
Identity = 46/65 (70.77%), Postives = 50/65 (76.92%), Query Frame = 2
Query:  146 KISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEEFDNLVVPEKMIG 340
            +I +LLHESLMLVT+LNP IGYD AA  AKKAHKE TTLK+A L LG   SEEFD  V P KMIG
Sbjct:  418 RIDQLLHESLMLVTALNPYIGYDKAAKAAKKAHKEKTTLKEACLSLGFTTSEEFDKWVDPSKMIG 482          

HSP 2 Score: 67.0106 bits (162), Expect = 1.718e-31
Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 3
Query:    3 VGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVRGIQANRER 149
            + GSNGHFELNVFKP+I   +L S+RL+ DAS SF K+CV GI+A+ +R
Sbjct:  370 IAGSNGHFELNVFKPVIIKNVLSSIRLIADASVSFTKHCVVGIKADEKR 418          
The following BLAST results are available for this feature:
BLAST of EY755965 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 97
Match NameE-valueIdentityDescription
FUM2_ARATH2.885e-4889.71Fumarate hydratase 2, chloroplastic OS=Arabidopsis... [more]
FUM1_ARATH2.886e-4889.71Fumarate hydratase 1, mitochondrial OS=Arabidopsis... [more]
FUMH_MACFA1.371e-3460.61Fumarate hydratase, mitochondrial OS=Macaca fascic... [more]
FUMH_HUMAN1.371e-3460.61Fumarate hydratase, mitochondrial OS=Homo sapiens ... [more]
FUMH_MOUSE1.371e-3460.61Fumarate hydratase, mitochondrial OS=Mus musculus ... [more]
FUMH_DANRE2.326e-3463.64Fumarate hydratase, mitochondrial OS=Danio rerio G... [more]
FUMH_RAT3.029e-3460.61Fumarate hydratase, mitochondrial OS=Rattus norveg... [more]
FUMH_PIG1.480e-3360.61Fumarate hydratase, mitochondrial OS=Sus scrofa GN... [more]
FUMH_RHIOR1.594e-3270.59Fumarate hydratase, mitochondrial OS=Rhizopus oryz... [more]
FUMH_DICDI1.718e-3170.77Fumarate hydratase, mitochondrial OS=Dictyostelium... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-A09-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755965 ID=EY755965|Name=EY755965|organism=Citrus sinensis|type=EST|length=647bp
CAGTGGGTGGATCAAATGGCCATTTTGAACTAAATGTATTCAAGCCAATG
ATTGCTAGTGGTCTCCTACATTCACTGAGATTGCTGGGAGATGCATCTGC
TTCTTTTGAGAAGAACTGTGTGAGAGGAATTCAAGCTAATAGGGAAAGAT
TTCCAAATTGCTGCACGAGTCATTGATGCTTGTCACATCCTTGAATCCTA
AAATTGGTTATGACAATGCTGCGGCAGTTGCCAAGAAGGCTCACAAGGAG
GGAACTACACTTAAGGATGCTGCATTGAAACTCGGAGTACTCAATAGTGA
AGAATTTGATAATCTTGTGGTACCTGAGAAAATGATTGGCCCATCCGACT
AACCAGCTTATGTGGGTTAAACTCCTGGGATTTGCTTTTGGCTTTTGTAT
CATTTTGCGGGATATCTGTTTCTGCGCCGTTTCTCTCCCTCAAGGCCTCA
ACTGAATCACTTGATAGGGATCCAAATAGTGATTTTGCTTTTATTTAAAA
AAACAAAGAAAGGGGCAACCAAAAAAAAACTATATTCTTGAGGNTTTCCC
AGGAGGAGGCTTCGGTGATATGTCATTTCACGTGGTGACAGAATAGCGAT
TGGTAGGCCCACAAAGGAAGACCTCCCTCATTTTTTGTGCGACAGTG
back to top