EY755964

Overview
NameEY755964
Unique NameEY755964
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length698
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2639 contig Csv1_Contig2639:252..949. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755964 vs. ExPASy Swiss-Prot
Match: RS6_ASPOF (40S ribosomal protein S6 OS=Asparagus officinalis GN=rps6 PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.043e-61
Identity = 126/176 (71.59%), Postives = 131/176 (74.43%), Query Frame = 2
Query:    5 RPGVLSPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLXXXXXXXXXXXXXXXXXXXXXXEYQKLLATRLKEQRERRSESLAKKRSRL 532
            + GVL+PGRVRLLLHRGTPCF                 CIVSPDLSVLNLVIVKKGE+DLPGLTD EKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFT K GK  SKAPKIQRLVTPLTL                      EYQKLLA+RLKEQR+RRSESLAKKRSRL
Sbjct:   64 KQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGENDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTNKKGKTCSKAPKIQRLVTPLTLQRKRARIAEKKKRVAKAKSEAAEYQKLLASRLKEQRDRRSESLAKKRSRL 239          
BLAST of EY755964 vs. ExPASy Swiss-Prot
Match: RS62_ARATH (40S ribosomal protein S6-2 OS=Arabidopsis thaliana GN=RPS6B PE=1 SV=3)

HSP 1 Score: 236.498 bits (602), Expect = 1.043e-61
Identity = 126/176 (71.59%), Postives = 131/176 (74.43%), Query Frame = 2
Query:    5 RPGVLSPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLXXXXXXXXXXXXXXXXXXXXXXEYQKLLATRLKEQRERRSESLAKKRSRL 532
            + GVL+PGRVRLLLHRGTPCF                 CIVSPDLSVLNLVIVKKG  DLPGLTDTEKPRMRGPKRASKIRKLFNL KEDDVRKYVNTYRRTFT K GKKVSKAPKIQRLVTPLTL                      +YQKLLA+RLKEQR+RRSESLAKKRSRL
Sbjct:   64 KQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGVSDLPGLTDTEKPRMRGPKRASKIRKLFNLGKEDDVRKYVNTYRRTFTNKKGKKVSKAPKIQRLVTPLTLQRKRARIADKKKRIAKANSDAADYQKLLASRLKEQRDRRSESLAKKRSRL 239          
BLAST of EY755964 vs. ExPASy Swiss-Prot
Match: RS61_ARATH (40S ribosomal protein S6-1 OS=Arabidopsis thaliana GN=RPS6A PE=1 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 6.757e-61
Identity = 124/176 (70.45%), Postives = 131/176 (74.43%), Query Frame = 2
Query:    5 RPGVLSPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLXXXXXXXXXXXXXXXXXXXXXXEYQKLLATRLKEQRERRSESLAKKRSRL 532
            + GVL+PGRVRLLLHRGTPCF                 CIVSPDLSVLNLVIVKKGE+DLPGLTDTEKPRMRGPKRASKIRKLFNL KEDDVR YVNTYRR FT K GK+VSKAPKIQRLVTPLTL                      +YQKLLA+RLKEQR+RRSESLAKKRSRL
Sbjct:   64 KQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGENDLPGLTDTEKPRMRGPKRASKIRKLFNLKKEDDVRTYVNTYRRKFTNKKGKEVSKAPKIQRLVTPLTLQRKRARIADKKKKIAKANSDAADYQKLLASRLKEQRDRRSESLAKKRSRL 239          
BLAST of EY755964 vs. ExPASy Swiss-Prot
Match: RS6_TOBAC (40S ribosomal protein S6 (Fragment) OS=Nicotiana tabacum GN=RPS6 PE=2 SV=2)

HSP 1 Score: 188.348 bits (477), Expect = 3.256e-47
Identity = 110/176 (62.50%), Postives = 119/176 (67.61%), Query Frame = 2
Query:    5 RPGVLSPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLXXXXXXXXXXXXXXXXXXXXXXEYQKLLATRLKEQRERRSESLAKKRSRL 532
            + GVL+PGRVRLLL+RGTPCF                 CIVSPDLSVLNLVIVKKGE+DLPGLTDTEKPRMRGP+   +   L+   KEDDVRKYVNT    FTTK   K SKAPKIQRLVTPLTL                      EYQKLLA+RLKEQRE+RSESLAKKRSRL
Sbjct:   19 KQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGENDLPGLTDTEKPRMRGPREPQRSEALY--FKEDDVRKYVNT-TAEFTTK--WKGSKAPKIQRLVTPLTLQRKRARIADKKKRIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRL 189          
BLAST of EY755964 vs. ExPASy Swiss-Prot
Match: RS6_ICTPU (40S ribosomal protein S6 OS=Ictalurus punctatus GN=rps6 PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 7.523e-36
Identity = 88/173 (50.87%), Postives = 105/173 (60.69%), Query Frame = 2
Query:    5 RPGVLSPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLXXXXXXXXXXXXXXXXXXXXXXEYQKLLATRLKEQRERRSESLAKKR 523
            + GVL+ GRVRLLL +G  C+                 CIV  +LSVLNLVI++KGE D+PGLTD+  PR  GPKRAS+IRKLFNLSKEDDVR+YV   RR  T +  K  +KAPKIQRLVTP  L                      EY KLLA RLKE +E+R E +AK+R
Sbjct:   64 KQGVLTNGRVRLLLSKGHSCYRPRRTGERKRKSVRG--CIVDANLSVLNLVIIRKGEKDIPGLTDSTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRRPLTKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKRQRTQKNKDEAAEYAKLLAKRLKEAKEKRQEKIAKRR 232          
BLAST of EY755964 vs. ExPASy Swiss-Prot
Match: RS6_RAT (40S ribosomal protein S6 OS=Rattus norvegicus GN=Rps6 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.283e-35
Identity = 88/173 (50.87%), Postives = 104/173 (60.12%), Query Frame = 2
Query:    5 RPGVLSPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLXXXXXXXXXXXXXXXXXXXXXXEYQKLLATRLKEQRERRSESLAKKR 523
            + GVL+ GRVRLLL +G  C+                 CIV  +LSVLNLVIVKKGE D+PGLTDT  PR  GPKRAS+IRKLFNLSKEDDVR+YV   R+    +  K  +KAPKIQRLVTP  L                      EY KLLA R+KE +E+R E +AK+R
Sbjct:   64 KQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRG--CIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRR 232          
BLAST of EY755964 vs. ExPASy Swiss-Prot
Match: RS6_MOUSE (40S ribosomal protein S6 OS=Mus musculus GN=Rps6 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.283e-35
Identity = 88/173 (50.87%), Postives = 104/173 (60.12%), Query Frame = 2
Query:    5 RPGVLSPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLXXXXXXXXXXXXXXXXXXXXXXEYQKLLATRLKEQRERRSESLAKKR 523
            + GVL+ GRVRLLL +G  C+                 CIV  +LSVLNLVIVKKGE D+PGLTDT  PR  GPKRAS+IRKLFNLSKEDDVR+YV   R+    +  K  +KAPKIQRLVTP  L                      EY KLLA R+KE +E+R E +AK+R
Sbjct:   64 KQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRG--CIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRR 232          
BLAST of EY755964 vs. ExPASy Swiss-Prot
Match: RS6_MACFA (40S ribosomal protein S6 OS=Macaca fascicularis GN=RPS6 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.283e-35
Identity = 88/173 (50.87%), Postives = 104/173 (60.12%), Query Frame = 2
Query:    5 RPGVLSPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLXXXXXXXXXXXXXXXXXXXXXXEYQKLLATRLKEQRERRSESLAKKR 523
            + GVL+ GRVRLLL +G  C+                 CIV  +LSVLNLVIVKKGE D+PGLTDT  PR  GPKRAS+IRKLFNLSKEDDVR+YV   R+    +  K  +KAPKIQRLVTP  L                      EY KLLA R+KE +E+R E +AK+R
Sbjct:   64 KQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRG--CIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRR 232          
BLAST of EY755964 vs. ExPASy Swiss-Prot
Match: RS6_HUMAN (40S ribosomal protein S6 OS=Homo sapiens GN=RPS6 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.283e-35
Identity = 88/173 (50.87%), Postives = 104/173 (60.12%), Query Frame = 2
Query:    5 RPGVLSPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLXXXXXXXXXXXXXXXXXXXXXXEYQKLLATRLKEQRERRSESLAKKR 523
            + GVL+ GRVRLLL +G  C+                 CIV  +LSVLNLVIVKKGE D+PGLTDT  PR  GPKRAS+IRKLFNLSKEDDVR+YV   R+    +  K  +KAPKIQRLVTP  L                      EY KLLA R+KE +E+R E +AK+R
Sbjct:   64 KQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRG--CIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRR 232          
BLAST of EY755964 vs. ExPASy Swiss-Prot
Match: RS6_BOVIN (40S ribosomal protein S6 OS=Bos taurus GN=RPS6 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.189e-35
Identity = 88/173 (50.87%), Postives = 103/173 (59.54%), Query Frame = 2
Query:    5 RPGVLSPGRVRLLLHRGTPCFXXXXXXXXXXXXXXXXXCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLXXXXXXXXXXXXXXXXXXXXXXEYQKLLATRLKEQRERRSESLAKKR 523
            + GVL+ GRVRLLL +G  C+                 CIV  +LSVLNLVIVKKGE D+PGLTDT  PR  GPKRAS+IRKLFNLSKEDDVR+YV   R+       K  +KAPKIQRLVTP  L                      EY KLLA R+KE +E+R E +AK+R
Sbjct:   64 KQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRG--CIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYV--VRKPLNKDGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRR 232          
The following BLAST results are available for this feature:
BLAST of EY755964 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
RS6_ASPOF1.043e-6171.5940S ribosomal protein S6 OS=Asparagus officinalis ... [more]
RS62_ARATH1.043e-6171.5940S ribosomal protein S6-2 OS=Arabidopsis thaliana... [more]
RS61_ARATH6.757e-6170.4540S ribosomal protein S6-1 OS=Arabidopsis thaliana... [more]
RS6_TOBAC3.256e-4762.5040S ribosomal protein S6 (Fragment) OS=Nicotiana t... [more]
RS6_ICTPU7.523e-3650.8740S ribosomal protein S6 OS=Ictalurus punctatus GN... [more]
RS6_RAT1.283e-3550.8740S ribosomal protein S6 OS=Rattus norvegicus GN=R... [more]
RS6_MOUSE1.283e-3550.8740S ribosomal protein S6 OS=Mus musculus GN=Rps6 P... [more]
RS6_MACFA1.283e-3550.8740S ribosomal protein S6 OS=Macaca fascicularis GN... [more]
RS6_HUMAN1.283e-3550.8740S ribosomal protein S6 OS=Homo sapiens GN=RPS6 P... [more]
RS6_BOVIN2.189e-3550.8740S ribosomal protein S6 OS=Bos taurus GN=RPS6 PE=... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-A07-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755964 ID=EY755964|Name=EY755964|organism=Citrus sinensis|type=EST|length=698bp
CACGCGTCCGGGAGTGCTGTCTCCCGGCCGTGTTCGTCTTCTGCTCCACC
GTGGTACCCCTTGCTTCCGTGGGTATGGCAGGAGAGATGGAGAGCGCAGG
AGGAAGTCTGTTCGTGGATGCATAGTTAGTCCAGATCTCTCCGTGTTGAA
TTTGGTCATTGTGAAAAAGGGAGAACATGACCTTCCTGGACTTACCGATA
CAGAAAAGCCCAGAATGAGAGGTCCCAAGAGAGCATCGAAGATCAGGAAG
TTGTTCAACCTTTCCAAGGAGGATGATGTTAGGAAGTACGTTAACACCTA
TCGTAGGACCTTCACAACAAAATCTGGTAAGAAGGTTAGCAAGGCACCGA
AAATTCAGAGGTTGGTAACTCCTTTGACTCTGCAAAGGAAGCGTGCAAGA
ATTGCAGAAAAGAAGCAGAGAATTGCCAAGGCCAAGGCTGAAGCAGCGGA
ATACCAGAAGCTCCTTGCTACCAGGTTGAAGGAGCAGCGTGAACGCCGCA
GTGAGAGTTTGGCAAAGAAGAGGTCTAGGCTCTCTGCTGCTTCAAAGCCA
TCTATTGCAGCTTAGATTAGATTCTTTGCTATAGTTGTTCTTTGGTCGGT
TATGTATTGTCCTGCTGAATTCTTTTCTATAGGTTGAGGAAATTTCGAGT
GTTTTTGACTTTATATCCCATGGAATGTGATACAATAACCTTCATGGN
back to top