EY755899

Overview
NameEY755899
Unique NameEY755899
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length541
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9965 contig Csv1_Contig9965:872..1412. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755899 vs. ExPASy Swiss-Prot
Match: DHGY_CUCSA (Glycerate dehydrogenase OS=Cucumis sativus GN=HPR-A PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.176e-44
Identity = 84/100 (84.00%), Postives = 94/100 (94.00%), Query Frame = 1
Query:   34 ALVEHLKQNPMFRVGLVVPEDEPYMKPGLSEMKNAIVVPHIASASKWTREGMATLAALNVLGKIKGYPIWGNPNQVEPFLNENAQPPAASPSIVNSKALG 333
            ALV+HL+ NPMFRVGL V EDEPYMKPGL++MKNAI+VPHIASASKWTREGMATLAALNVLGKIKGYP+W +PN+VEPFL+EN  PPAASPSIVN+KALG
Sbjct:  281 ALVDHLRDNPMFRVGLDVFEDEPYMKPGLADMKNAIIVPHIASASKWTREGMATLAALNVLGKIKGYPVWSDPNRVEPFLDENVSPPAASPSIVNAKALG 380          
The following BLAST results are available for this feature:
BLAST of EY755899 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
DHGY_CUCSA1.176e-4484.00Glycerate dehydrogenase OS=Cucumis sativus GN=HPR-... [more]
back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-001-B09-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755899 ID=EY755899|Name=EY755899|organism=Citrus sinensis|type=EST|length=541bp
GTCAAAAAGAGCCCGCGTCCGGATTGATTACCAGCTCTGGTGGAGCATTT
GAAACAAAATCCAATGTTTCGTGTCGGTCTTGTTGTCCCTGAGGATGAGC
CTTACATGAAGCCTGGACTCTCTGAAATGAAGAACGCCATCGTGGTACCT
CACATTGCTTCCGCGTCCAAGTGGACTCGTGAAGGAATGGCAACCCTTGC
TGCTCTGAATGTCCTGGGAAAGATCAAAGGATACCCCATATGGGGTAACC
CAAATCAAGTAGAACCATTCTTGAACGAGAATGCTCAGCCTCCTGCTGCA
AGTCCAAGCATTGTGAACTCAAAGGCATTGGGTTTGCCGGTTTCAAGGCT
TTAAGCTCTCAGCAGCTTCACCACATCGGGGCCTAATGGTGTGCATAGAG
AGCACCTTACTAAGTTTGAAGTGTATTTTGATGTGAGTGTTCAAAATTTT
CATTATGAGAAGCATTAACAACCATGTACGTACGTGCTTTCGCGCAGTTG
TGTTGTATTGACTGGCTTCATAAAAAAAAAAAAAAAAAAAA
back to top